379 Inventos, patentes y modelos industriales publicados el Miércoles 01 de Noviembre de 2017.

Procedimiento de decodificación de una imagen mediante intra-predicción.

(01/11/2017) Un procedimiento de decodificación de una imagen mediante intra-predicción, estando el procedimiento caracterizado porque comprende: dividir un cuadro actual de la imagen en al menos un bloque que tiene un tamaño predeterminado; extraer un modo de intra-predicción de un bloque actual a partir de una secuencia de bits, indicando el modo de intra-predicción una dirección particular entre una pluralidad de direcciones, indicándose la dirección particular mediante i) un número dx en una dirección horizontal y un número fijo en una dirección vertical, o ii) un número dy en la dirección vertical y el número fijo en la dirección horizontal; y realizar una intra-predicción…

Pasta de impresión suspendible en agua.

(01/11/2017) Procedimiento para la estructuración de sustratos, en el que a. una pasta de impresión se aplica en un modelo o una estructuración sobre un sustrato , conteniendo la pasta de impresión una suspensión acuosa que contiene: - 30% en peso a 83% en peso de agua (A) - 0,2% en peso a 40% en peso de polímero hidrofílico (B) con poli(acetato de vinilo) o poli(alcohol vinílico), - 1% en peso a 35% en peso de disolvente orgánico polar (C) que contiene etilenglicol, glicerol, propilenglicol, butilglicol, N-metil-2-pirrolidona y/o mezclas de los mismos y - 0,01% en peso a 2% en peso de antiespumante (D) que contiene alcoholes con 1 a 12 átomos de carbono, glicéridos…

Anticuerpos contra el virus de la influenza y métodos para su uso.

Secciones de la CIP Necesidades corrientes de la vida Física Química y metalurgia

(01/11/2017). Solicitante/s: DANA-FARBER CANCER INSTITUTE, INC.. Inventor/es: MARASCO,WAYNE A, SUI,JIANHUA, LIDDINGTON,ROBERT C. Clasificación: A61K39/395, G01N33/50, C07K16/10.

Un anticuerpo monoclonal aislado o anticuerpo scFv, en el que dicho anticuerpo se une a un epítopo en la región del tallo de la proteína hemaglutinina (HA) de un virus de la influenza y neutraliza el virus de la influenza A, donde las secuencias de aminoácidos de las regiones variables de la cadena pesada consisten en FR1 QVQLVQSGAEVKKPGSSVKVSCTSS CDR1 EVTFSSFA FR2 ISWVRQAPGQGLEWLGG CDR2 ISPMFGTP FR3 NYAQKFQGRVTITADQSTRTAYMDLRSLRSEDTAVYYC CDR3 ARSPSYICSGGTCVFDH FR4 WGQGTLVTVSS y las secuencias de aminoácidos de las regiones variables de la cadena ligera consisten en FR1 QPGLTQPPSVSKGLRQTATLTCTGN CDR1 SNNVGNQG FR2 AAWLQQHQGHPPKLLSY CDR2 RNN FR3 DRPSGISERFSASRSGNTASLTITGLQPEDEADYYC CDR3 STWDSSLSAVV FR4 FGGGTKLTVL.

PDF original: ES-2649536_T3.pdf

Acondicionador de aire.

(01/11/2017) Acondicionador de aire instalado empotrado en el techo de una sala acondicionada por aire, que comprende: - una carcasa que comprende: una parte inferior de carcasa compuesta por una secuencia alterna de una pluralidad de partes de lado (30a - 30d) y una pluralidad de partes de esquina (30e - 30h); salidas de parte de lado (12a - 12d) dispuestas a lo largo de cada una de dichas partes de lado; salidas de parte de esquina (12e - 12h) dispuestas en al menos una de dicha pluralidad de partes de esquina; y una entrada dispuesta de manera que está rodeada por todas de dichas partes de lado; y - un ventilador , dispuesto en el interior de dicha carcasa,…

Procedimiento para calentar hojas de vidrio, y horno de vidrio.

(01/11/2017) Un procedimiento para calentar una hoja de vidrio en un horno para templar vidrio que tiene una estructura porticada que comprende una parte superior y una parte inferior , que pueden moverse la una en relación con la otra en la dirección vertical del horno para templar vidrio, y al menos un canal de soplado dispuesto en su parte superior , y procedimiento en el que la hoja de vidrio se alimenta al horno para templar vidrio, la hoja de vidrio se calienta en el horno para templar vidrio al menos soplando aire de calentamiento sobre la superficie superior de la hoja de vidrio a través de al menos un canal de soplado, la distancia (D) de soplado…

Enzimas que tienen actividad de alfa amilasa y métodos de uso de las mismas.

(01/11/2017) Un ácido nucleico aislado, sintético o recombinante que comprende: (A) (i) una secuencia que codifica un polipéptido que tiene actividad de alfa amilasa, en la que dicha secuencia tiene por lo menos 90%, 95%, 96%, 97%, 98%, 99% o 100% de identidad de secuencia con la secuencia de la SEQ ID NO: 53, o fragmentos enzimáticamente activos de las mismas, en donde el fragmento tiene actividad de alfa amilasa, o (ii) la secuencia de (i), en la que la identidad de la secuencia se determina por análisis con un algoritmo de comparación de secuencias, o se determina mediante inspección visual, o (iii) la secuencia de (ii), en la que el algoritmo de comparación de secuencias…

Procedimiento para operar un dispositivo de iluminación de un automóvil con función de atenuación automática.

(01/11/2017) Procedimiento para operar un dispositivo de iluminación de un automóvil con función atenuadora automática, que comprende al menos un faro con una fuente de iluminación en forma de al menos un LED , un dispositivo digital de registro de imágenes que registra la parte frontal del automóvil, el cual suministra cíclicamente imágenes individuales, y un dispositivo de control que se comunica con el dispositivo de registro de imágenes, el cual determina la situación de tráfico por medio de las imágenes y dependiendo del resultado de la determinación controla los LED para atenuarlos, caracterizado por que la frecuencia (f1) con la cual se modula la operación lumínica de los…

Procedimiento de fabricación de un conjunto de almacenamiento de energía eléctrica.

(01/11/2017) Procedimiento de fabricación de un conjunto de almacenamiento de energía eléctrica que comprende por lo menos: - una envuelta externa que comprende una zona de acoplamiento , estando la envuelta externa abierta en por lo menos uno de sus extremos, - por lo menos una tapa que comprende una zona de acoplamiento , estando la tapa destinada a ser posicionada a nivel del extremo abierto de la envuelta externa, de modo que la zonas de acoplamiento estén una enfrente de otra, - incluyendo por lo menos una de las zonas de acoplamiento por lo menos una porción en relieve , estando el procedimiento caracterizado por que comprende una etapa de cierre que consiste…

Método para preparar la forma activa de la proteína de fusión TNRF-Fc.

(01/11/2017) Un método para preparar una proteína activa de fusión TNFR (receptor del factor de necrosis tumoral) - Fc, que comprende: a) cargar una muestra que comprende una mezcla de proteínas de fusión TNFR-Fc producidas en células de mamífero en una cantidad de 10 a 14 g/L de lecho por volumen de resina de cromatografía, a una columna de cromatografía de interacción hidrófoba (HIC) preequilibrada con un tampón de equilibrado que comprende una o más sales elegidas entre el grupo que consiste en citrato sódico, sulfato sódico y fosfato sódico; b) lavar la columna con un tampón de lavado que comprende la misma sal que en el tampón de equilibrado para eliminar las formas recortadas de…

Aparato de pruebas inmunodiagnósticas que tiene por lo menos un generador de imágenes para proporcionar evaluaciones de aglutinación avanzadas durante el ciclo de centrifugación.

(01/11/2017) Un aparato de pruebas inmunodiagnósticas, dicho aparato comprendiendo: una carcasa; un controlador ; un elemento de prueba que comprende por lo menos una tarjeta de gel o un casete de perlas; una centrífuga dispuesta dentro de dicha carcasa, dicha centrífuga incluyendo un miembro de brazo rotatorio que tiene un par de extremos opuestos que se extienden radialmente hacia afuera desde un cubo central en donde cada uno de los extremos del miembro de brazo rotatorio está configurado para sostener por lo menos un elemento de prueba sobre él para la centrifugación durante un periodo de tiempo predeterminado como se controla por dicho controlador ; un…

Sistemas y procedimientos de producción de proteínas.

Sección de la CIP Química y metalurgia

(01/11/2017). Solicitante/s: WYETH LLC. Inventor/es: LU, ZHIJIAN, GAO,YIJIE, PICHE,NICOLE M, GENG,MEI, HERRMANN,STEPHEN H, ZHONG,XIAOTIAN, KRIZ,RONALD. Clasificación: C12N15/85, C12N15/82, C12N15/63.

Un cultivo celular animal o vegetal transfectado o trasnducido con uno o más vectores de expresión que comprende: (a) al menos un casete de expresión recombinante que codifica dicha proteína de interés; y (b) al menos otro casete de expresión recombinante que codifica: (i) una proteína XBP1 que tiene la secuencia de aminoácidos de SEQ ID NO:6 o un fragmento de la misma, en el que dicha proteína o fragmento de la misma se une a un elemento RPD (ERPD) o a un elemento de respuesta al estrés del RE (ERERE) de dicha célula; o (ii) una proteína ATF6 que tiene la secuencia de aminoácidos de SEQ ID NO:9 o de los restos de aminoácidos 1-366 de SEQ ID NO:9, en el que dicha proteína se une a un elemento RPD (ERPD) o a un elemento de respuesta al estrés del RE (ERERE) de dicha célula; en el que la relación entre el número total de dicho al menos un casete de expresión recombinante y el número total de dicho al menos otro casete de expresión recombinante es al menos 3:1.

PDF original: ES-2653843_T3.pdf

Agente de lavado o de limpieza líquido muy concentrado.

(01/11/2017) Agente de lavado o de limpieza líquido que contiene: a) del 18 al 35 5 % en peso, con respecto a todo el agente de lavado o de limpieza, de tensioactivo aniónico del tipo sulfonato seleccionado del grupo que consta de alquilbencenosulfonatos C9-13, sulfonatos de olefina, estólidos sulfonados, alcanosulfonatos C12-18 y mezclas de los mismos, b) del 15 a 25 % en peso, con respecto a todo el agente de lavado o de limpieza, de tensioactivo no iónico seleccionado del grupo que consta de alcoholes grasos alcoxilados, oxoalcoholes alcoxilados, alquilpoliglucósidos y mezclas de los mismos, c) del 2 al 15 % en peso, con respecto a todo el agente de lavado o de limpieza, de tensioactivo…

Artículo de consumo de tipo toallita de fregar y método para fabricar el mismo.

Secciones de la CIP Textiles y papel Necesidades corrientes de la vida Técnicas industriales diversas y transportes

(01/11/2017). Solicitante/s: 3M INNOVATIVE PROPERTIES COMPANY. Inventor/es: JOHNSON, MITCHELL T.,, LINDQUIST,TIMOTHY J. Clasificación: D06P5/00, D04H1/46, D06N3/00, D06N7/00, A47L13/16, B24D18/00, B24D3/00, A47L13/17, D06M23/16.

Un artículo de consumo de tipo toallita de fregar que comprende: un sustrato no tejido que tiene un gramaje seco inferior a 300 g/m2; y una capa de textura basada en resina abrasiva no reticulada impresa sobre al menos una superficie del sustrato, de tal forma que la capa de textura se extiende al menos 50 μm (micrómetros) hacia afuera más allá de la superficie del sustrato tras la coalescencia, en donde la capa de textura cubre menos de una totalidad de la superficie del sustrato, y en donde la capa de textura incluye una resina que confiere independientemente una característica de capacidad de fregado al artículo de tipo toallita de fregar tras coalescencia y unión al sustrato no tejido.

PDF original: ES-2655502_T3.pdf

Aplicación de dióxido de carbono en la remediación de suelos, sedimentos y acuíferos contaminados.

Secciones de la CIP Química y metalurgia Técnicas industriales diversas y transportes

(01/11/2017). Solicitante/s: Societa' Italiana Acetilene & Derivati S.I.A.D. S.p.A. in abbreviated form SIAD S.p.A. Inventor/es: BISSOLOTTI,GIORGIO, PASINETTI,ELEONORA, PERONI,MICHELA. Clasificación: C02F1/00, B09C1/00, B09C1/02.

Un procedimiento para la remediación de suelos que comprende la inyección y/o difusión de dióxido de carbono usado como disolvente para los contaminantes que son transportados de esta manera en la capa superior del suelo, caracterizándose el procedimiento por las siguientes etapas adicionales: - excavación y eliminación de la capa superficial en la que se concentran todos los contaminantes; - recuperación y reutilización de CO2 mediante sistemas de control de captura y extracción mediante succión y/o presión; - purificación del CO2 extraído con el fin de eliminar partículas, humedad, fracción contaminante arrastrada y gases.

PDF original: ES-2655694_T3.pdf

Dispositivos anastomóticos y métodos.

(01/11/2017) Dispositivo para fístula que comprende: un conducto generalmente continuo para permitir un flujo entre un primer vaso y un segundo vaso y que tiene una parte proximal y una parte distal ; un soporte adaptable que se puede colocar en la parte distal y configurado para expandirse hacia afuera, hacia las paredes internas del segundo vaso cuando se despliega, en el que el soporte adaptable es suficientemente flexible y generalmente adaptable para minimizar la distensión radial del segundo vaso después del despliegue; y un dispositivo de puerto de pared lateral conectado al conducto y que se puede colocar en la parte proximal y configurado para acoplarse a una…

Método para detectar un objeto usando ondas ultrasónicas y dispositivo de detección para un objeto usando el mismo.

(01/11/2017) Un método de detección de objeto usando ondas ultrasónicas, que comprende: - emitir secuencialmente (S110) una pluralidad de señales ultrasónicas separadas por un intervalo de tiempo dado; - percibir (S120) una onda de sonido, una señal reflejada, formada por la señal ultrasónica reflejada por un objeto; y - analizar (S130) la señal reflejada para detectar el al menos un objeto, comprendiendo el paso de analizar de cada señal reflejada: muestrear (S131) la señal reflejada en una pluralidad de tiempos de muestreo para generar una pluralidad de valores de muestra de la amplitud de la señal reflejada, y almacenar los valores de muestra generados, asociados cada uno respectivamente…

Compuestos antagonistas de E-selectina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(01/11/2017). Solicitante/s: GlycoMimetics, Inc. Inventor/es: MAGNANI,John L, SARKAR,Arun K, BAEK,MYUNG-GI, ANDERSON,FRANK E. III, LI,YANHONG. Clasificación: A61P35/00, A61K31/7034, C07H15/207.

Un compuesto que tiene la fórmula:**Fórmula** o una sal, estereoisómero, tautómero, hidrato o solvato de este farmacéuticamente aceptable caracterizado porque n es 4, 8, 12, 16, 20, 24 o 28.

PDF original: ES-2655443_T3.pdf

Conjugado de factor VIIa - ácido (poli)siálico que tiene una semivida in vivo prolongada.

Sección de la CIP Necesidades corrientes de la vida

(01/11/2017). Solicitante/s: Baxalta GmbH. Inventor/es: TURECEK, PETER, SCHEIFLINGER, FRIEDRICH, SIEKMANN,JUERGEN, CANAVAGGIO,MICHEL. Clasificación: A61P7/00, A61K47/61, A61K47/54.

Molécula de FVIIa químicamente modificada que comprende: (a) una molécula de FVIIa seleccionada del grupo que consiste en FVIIa plasmático y FVIIa recombinante (rFVIIa); y (b) al menos un resto de hidrato de carbono fisiológicamente aceptable que comprende de 1 a 4 restos de ácido siálico unido o ácido polisiálico unidos a uno o más restos de hidrato de carbono oxidados en dicho FVIIa; y en la que la semivida in vivo de dicha molécula de FVIIa químicamente modificada se prolonga en la sangre de un mamífero en comparación con la semivida in vivo de una molécula de FVIIa que no está químicamente modificada.

PDF original: ES-2655639_T3.pdf

Procedimiento de preparación de una sal de succinato monovalente.

(01/11/2017) Un procedimiento de preparación de una sal de succinato de sodio o potasio que comprende los pasos de: a) fermentar a ácido succínico una fuente de carbohidratos por medio de un microorganismo, b) añadir un hidróxido o carbonato de metal alcalinotérreo, siendo el metal alcalinotérreo calcio o magnesio, como agente neutralizante durante la fermentación bajo la formación de un medio acuoso que comprende succinato de calcio o succinato de magnesio, c) hacer reaccionar la sal de succinato de metal alcalinotérreo en un medio acuoso con una base de hidróxido o carbonato de sodio o potasio para formar un hidróxido o carbonato de metal alcalinotérreo y una sal de succinato de sodio o potasio, …

Composición farmacéutica para el tratamiento y/o la prevención del cáncer de hígado.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(01/11/2017). Solicitante/s: TORAY INDUSTRIES, INC.. Inventor/es: OKANO, FUMIYOSHI, IDO,TAKAYOSHI, SAITO,TAKANORI, MINAMIDA,YOSHITAKA. Clasificación: A61P35/00, C12N15/09, A61K39/395, C07K16/18, C07K16/46.

Una composición farmacéutica para su uso en un método para tratar el cáncer de hígado, que comprende, como principio activo, un anticuerpo o un fragmento del mismo que se unen a una proteína CAPRIN-1 que comprende una secuencia de aminoácidos expuesta en cualquier secuencia con número par de las SEQ ID NO: 2 a 30 o una secuencia de aminoácidos que tiene una identidad de secuencia del 80 % o más respecto de la secuencia de aminoácidos o un fragmento de la proteína CAPRIN-1 que comprende al menos siete restos de aminoácidos consecutivos de la secuencia de aminoácidos de la proteína.

PDF original: ES-2656620_T3.pdf

Aparato para envolver balas y dispositivo de control asociado.

(01/11/2017) Un aparato para envolver balas, que comprende una plataforma de soporte para una bala (A), compuesta de productos agrícolas cortados previamente, tal como hierba, trigo, maíz, heno, forraje y similares, y unos medios de movimiento para mover la bala (A), cuando se coloca sobre dicha plataforma , de acuerdo con al menos dos ejes de rotación perpendiculares entre sí (B, C), al menos un cargador para suministrar un elemento de recubrimiento (D) que se puede enrollar de manera automática alrededor de la bala (A), durante su rotación en torno a dichos ejes de rotación (B, C) para su envoltura, está orientado hacia dicha plataforma y está cerca de esta, caracterizado por que comprende al…

Registros múltiples de IP móvil e interacciones de PCC.

(01/11/2017) Un procedimiento para el suministro de reglas de política para múltiples sesiones de paquete de datos a través de una red de comunicación inalámbrica a un equipo de usuario, UE, , que comprende: establecer una primera sesión de protocolo de Internet, IP a través de una primera pasarela de acceso para el UE para comunicaciones de paquetes de datos inalámbricas obteniendo una dirección IP proporcionada por una función de aplicación de política de acceso en una nodo de acceso, en el que la primera sesión de IP se establece entre el UE y el nodo de acceso; instanciar una segunda sesión de IP para el UE para las comunicaciones de paquetes de datos inalámbricas enlazando la…

Síntesis y uso de material de siembra de yeso.

(01/11/2017) Procedimiento de producción de dihidrato de sulfato de calcio haciendo reaccionar un compuesto de calcio hidrosoluble con un compuesto de sulfato hidrosoluble en presencia de agua y un polímero que contiene grupos ácido, caracterizado porque el polímero que contiene grupos ácido comprende grupos poliéter de unidad estructural (I) *-U-(C(O))k-X-(AlqO)n-W (I) en la que * indica el sitio de unión al polímero que contiene grupos ácido, U representa un enlace químico o un grupo alquileno que tiene de 1 a 8 átomos de carbono, X es oxígeno o un grupo NR1, k es 0 o 1, n es un número entero con una media, basada en el polímero que contiene grupos ácido, en el intervalo de 3…

Formas sólidas de 3-(5-amino-2-metil-4-oxo-4H-quinazolin-3-il)-piperidina-2,6-diona y sus composiciones farmacéuticas y usos.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(01/11/2017). Solicitante/s: CELGENE CORPORATION. Inventor/es: MULLER, GEORGE, W., MAN, HON-WAH, LEONG, WILLIAM, W., XU,JEAN, LI,YING, COHEN,BENJAMIN M. Clasificación: A61P35/00, C07D401/04, A61K31/517.

Una forma sólida de una sal hidrocloruro de 3-(5-amino-2-metil-4-oxo-4H-quinazolin-3-il)-piperidina-2,6-diona:**Fórmula** que tiene un patrón de difracción de rayos X en polvo que comprende picos a aproximadamente 8,6, 13,1, 20,5 y 26,3 grados 2θ.

PDF original: ES-2656855_T3.pdf

Bomba de accionamiento magnético.

(01/11/2017) Una bomba de accionamiento magnético que tiene una carcasa de bomba , en que la carcasa de la bomba está hecha de hierro fundido o acero inoxidable que incluye un soporte anterior , una entrada , una voluta , una salida , una brida trasera de carcasa y un forro de revestimiento (4a); en que la carcasa de la bomba se utiliza para contener un impulsor , la entrada se utiliza para conectarse a una entrada del impulsor con palas impulsoras para convertir la potencia del eje a potencia hidráulica, y el fluido presurizado entra en la voluta y a continuación sale por la salida ; y la bomba de accionamiento magnético se caracteriza porque: el revestimiento de la carcasa (4a) está…

Dispositivo de electroestimulación.

(01/11/2017) Dispositivo de electroestimulación adaptado para estimular el área motora suplementaria, el área premotora y/o el núcleo subtalámico a través de los músculos auriculares que comprende: por lo menos dos electrodos configurados para permitir enviar y recibir señales eléctricas, por lo menos una unidad de control configurada para permitir que las señales sean enviadas a/recibidas desde los electrodos un electrodo de tierra configurado para proporcionar el cierre del circuito de la corriente eléctrica proporcionando una camino eléctrico al terminal negativo de una fuente de alimentación, la unidad de control configurada para generar señales de estimulación que tienen la frecuencia…

Seguridad y comprobación de la hora del sistema de una estación de recarga.

(01/11/2017) Método para verificar una información de tiempos facilitada en un contador de corriente y/o en una estación de recarga para vehículos eléctricos que comprende: - captar la información de tiempos facilitada en el contador de corriente y/o en la estación de recarga para vehículos eléctricos, - recibir un valor aleatorio alfanumérico desconocido en el contador de corriente y/o en la estación de recarga para vehículos eléctricos, elaborado por una estación de comprobación separada espacialmente del contador de corriente y/o de la estación de carga para vehículos eléctricos, - elaborar un paquete de datos que comprenda por lo menos la información de tiempos y el valor aleatorio…

Elemento tubular.

(01/11/2017) Elemento tubular utilizable como elemento estructural de forma tubular cilíndrica cuando se infla hasta una presión de entre 10 y 20 psi (de 6,89 a 13,79 * 104 pascales); siendo el elemento tubular flexible cuando se desinfla y sustancialmente inflexible cuando se infla hasta dicha presión, y que puede inflarse repetidamente hasta dicha presión tras desinflarse para plegar el elemento tubular; incluyendo el elemento tubular hebras de refuerzo textiles internas entre una capa interior formada a partir de un material seleccionado entre caucho, sustitutos del mismo y plásticos y una capa exterior formada a partir del mismo material, incluyendo las hebras de refuerzo textiles internas hebras …

Artículo absorbente y canales de formación de núcleo absorbente cuando están húmedos.

(01/11/2017) Un artículo absorbente para la higiene personal que tiene un eje longitudinal y comprende: una lámina superior permeable a los líquidos, una lámina de respaldo impermeable a los líquidos, un núcleo absorbente entre la lámina superior y la lámina de respaldo, comprendiendo el núcleo absorbente una envoltura de núcleo que encierra un material absorbente , comprendiendo el material absorbente un polímero superabsorbente, en donde la envoltura de núcleo comprende una cara superior y una cara inferior (16'), y la envoltura de núcleo está formada a partir de materiales seleccionados a partir de papel, papeles tisú, películas, materiales tejidos o no tejidos, o laminados de cualquiera…

Plantas resistentes a enfermedad.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(01/11/2017). Solicitante/s: SciENZA Biotechnologies 4 B.V. Inventor/es: VAN DAMME,MIREILLE MARIA AUGUSTA, VAN DEN ACKERVEKEN,AUGUSTINUS FRANCISCUS J. M. Clasificación: C12N15/82, C12N9/02, A01H5/08.

Planta de uva que es resistente a Plasmopara viticola caracterizada porque la planta tiene un nivel reducido o ausencia completa de proteína DMR6 en comparación con la planta que no es resistente a dicho patógeno en donde dicha planta tiene una mutación en su gen DMR6 que da como resultado una expresión DMR6 reducida en comparación con el gen DMR6 de tipo salvaje en donde no está presente tal mutación.

PDF original: ES-2656396_T3.pdf

Un complejo covalente de factor de von Willebrand y factor VIII asociado por un puente disulfuro.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(01/11/2017). Solicitante/s: CSL Ltd. Inventor/es: METZNER, HUBERT, WEIMER, THOMAS, DR., SCHULTE,STEFAN,DR. Clasificación: A61P7/04, C07K14/755, A61K38/37.

Un complejo covalente de factor de von Willebrand (VWF) o variantes del mismo y variantes del factor VIII, que comprende un resto que prolonga la semivida, a condición de que dichas variantes del factor VIII retengan al menos el 10 % de la actividad biológica de FVIII no mutado, en el que el factor VIII se modifica de manera que forme un puente disulfuro con VWF, por lo que el factor VIII se modifica por sustitución de un aminoácido que existe de forma natural con un resto de cisteína o la inserción de un resto de cisteína que forma un puente disulfuro con un resto de cisteína en el factor de von Willebrand.

PDF original: ES-2657291_T3.pdf

Sistema hidráulico.

(01/11/2017) Sistema de convertidor, en particular de accionamiento, hidráulico, con al menos un hidrostato , que comprende un árbol de accionamiento , al menos un dispositivo de registro para el registro de un parámetro de funcionamiento del hidrostato , así como un dispositivo de control y/o regulación para controlar y/o regular al menos un parámetro de sistema en función del parámetro de funcionamiento registrado del hidrostato, presentando el dispositivo de registro un sensor de momento de giro integrado en el hidrostato , asociado a su árbol de accionamiento , para registrar el momento de giro de árbol de accionamiento del hidrostato y presentando el dispositivo de control y/o regulación medios…