45 patentes, modelos y diseños de DANA-FARBER CANCER INSTITUTE, INC.

Procedimientos para la predicción de una respuesta contra el cáncer.

Sección de la CIP Química y metalurgia

(26/12/2018). Inventor/es: RICHARDSON,ANDREA L, WANG,ZHIGANG C, SILVER,DANIEL P, SZALLASI,ZOLTAN, BIRKBAK,NICOLAI JUUL, EKLUND,ARON C. Clasificación: C12Q1/6886.

Procedimiento para determinar un régimen de tratamiento adecuado para un sujeto con cáncer, que comprende: determinar en una muestra biológica que comprende células tumorales de un sujeto, el número de desequilibrios alélicos presentes en una pluralidad de regiones cromosómicas que se extienden hacia y que comprenden 5 al menos un telómero, pero que no cruzan el centrómero, en el que, cuando hay un mayor número de desequilibrios alélicos en relación a un control, se determina que un régimen de tratamiento que comprende al menos un agente quimioterapéutico basado en platino o al menos un inhibidor de poli(ADP ribosa) polimerasa (PARP), es un régimen de tratamiento adecuado, y que cuando no hay un mayor número de desequilibrios alélicos en relación a un control, se determina que un régimen de tratamiento que no comprende un agente quimioterapéutico basado en platino ni un inhibidor de poli(ADP ribosa) polimerasa (PARP), es un régimen de tratamiento adecuado.

PDF original: ES-2704303_T3.pdf

Mutantes C-RAF que confieren resistencia a los inhibidores de RAF.

Secciones de la CIP Física Química y metalurgia

(18/04/2018). Inventor/es: EMERY,CAROLINE, GARRAWAY,LEVI A, ANTONY,RAJEE. Clasificación: G01N33/574, C07K14/435.

Una molécula de ácido nucleico que codifica un polipéptido C-RAF mutante que tiene actividad C-RAF o un polipéptido C-RAF mutante que tiene actividad C-RAF, en los que dicho polipéptido C-RAF mutante comprende al menos una sustitución de aminoácido seleccionada del grupo que consiste en 257S>P, 261P>T, 361G>A y 478E>K en comparación con un polipéptido C-RAF de tipo silvestre que comprende SEQ ID NO: 2, confiriendo la al menos una sustitución de aminoácido resistencia a uno o más inhibidores de RAF en una célula que expresa el polipéptido C-RAF mutante, estando el inhibidor de RAF seleccionado de PLX 4720, PLX4032 y (S)-metil-1-(4-(3-(5-cloro-2-fluoro-3-(metilsulfonamido)fenil)-1-isopropil-1H-pirazol-4-il)pirimidin-2-ilamino)propan-2-il-carbamato.

PDF original: ES-2673070_T3.pdf

Mutaciones de BRAF que confieren resistencia a inhibidores de BRAF.

(21/03/2018) Un método para identificar un inhibidor de BRAF de segunda generación, que comprende: a) seleccionar un fármaco potencial usando modelización asistida por ordenador con una estructura cristalina tridimensional o en solución de un polipéptido de BRAF mutante, en el que dicho polipéptido de BRAF mutante comprende una secuencia de aminoácidos que tiene al menos una sustitución de aminoácido en comparación con un polipéptido de BRAF V600E que tiene SEQ ID NO: 4, confiriendo la al menos una sustitución de aminoácido resistencia a uno o más inhibidores de BRAF en el polipéptido de BRAF mutante, en el que la al menos una sustitución de aminoácido se selecciona del grupo que consiste en A29, H72, S113, S124, P162, C194, L227, P231,…

Enriquecimiento de una PCR por COLD completa con secuencia de bloqueo de referencia.

(10/01/2018) Un método para enriquecer una secuencia de ácido nucleico diana en una mezcla de reacción de amplificación, comprendiendo dicho método: a. proporcionar un par de cebadores capaz de reasociarse a una secuencia de referencia y también a una o más secuencias diana que son al menos 50% homólogas a dicha secuencia de referencia; b. preparar una mezcla de reacción de amplificación que incluye al menos los siguientes constituyentes: una muestra de ácido nucleico que tiene la secuencia de referencia y de la que se sospecha que tiene la una o más secuencias diana que son al menos 50% homólogas a dicha secuencia de referencia y que también son amplificables por el par de cebadores, y una cantidad en exceso de la secuencia de bloqueo de referencia con relación…

Una mutación de MEK1 que confiere resistencia a inhibidores de RAF y de MEK.

Secciones de la CIP Química y metalurgia Física

(10/01/2018). Inventor/es: EMERY,CAROLINE, GARRAWAY,LEVI A, WAGLE,NIKHIL. Clasificación: C12Q1/68, G01N33/574, C12N9/12.

Una molécula de ácido nucleico aislada que codifica una proteína MEK1 mutante que tiene actividad de MEK1, ácido nucleico que codifica la proteína MEK1 mutante que comprende SEQ ID NO: 4 que tiene una sustitución del aminoácido de cisteína a serina en la posición 121 de la proteína MEK1 de tipo silvestre de SEQ ID NO: 2, confiriendo la sustitución del aminoácido resistencia a un inhibidor de RAF y a un inhibidor de MEK en una célula que expresa la proteína MEK1 mutante, en la que el inhibidor de RAF se selecciona de PLX4720 y PLX4032, y el inhibidor de MEK es AZD6244.

PDF original: ES-2660239_T3.pdf

Inhibidores de EGFR y procedimiento de tratamiento de trastornos.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(10/01/2018). Inventor/es: GRAY,NATHANAEL S, ZHOU,WENJUN, JANNE,PASI, ECK,MICHAEL J. Clasificación: A61P35/00, C07D403/14, A61P19/02, A61K31/52, C07D473/16.

Un compuesto que tiene la siguiente estructura: **(Ver fórmula)** en la que X ≥ O e Y ≥ H, X ≥ O e Y ≥ OMe, o X ≥ S e Y ≥ H.

PDF original: ES-2659725_T3.pdf

Anticuerpos monoclonales humanizados y métodos de uso.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(01/11/2017). Inventor/es: SUI,JIANHUA, AVNIR,YUVAL, MARASCO,WAYNE. Clasificación: A61K39/00, A61K39/395, C12P21/08, A61K39/145, C07K16/10, C07K16/42.

Un anticuerpo monoclonal G6 murino humanizado aislado que se une específicamente a la región variable de la cadena pesada de la inmunoglobulina humana codificada por el gen VH1-69 de la línea germinal o un fragmento de este, en donde dicho anticuerpo o dicho fragmento comprende: a) una región variable de cadena pesada que comprende la secuencia de aminoácidos:**Fórmula** una región variable de cadena ligera que comprende la secuencia de aminoácidos:**Fórmula** b) una región variable de cadena pesada que comprende la secuencia de aminoácidos:**Fórmula** una región variable de cadena ligera que comprende la secuencia de aminoácidos:**Fórmula**.

PDF original: ES-2648885_T3.pdf

Anticuerpos contra el virus de la influenza y métodos para su uso.

Secciones de la CIP Necesidades corrientes de la vida Física Química y metalurgia

(01/11/2017). Inventor/es: MARASCO,WAYNE A, SUI,JIANHUA, LIDDINGTON,ROBERT C. Clasificación: A61K39/395, G01N33/50, C07K16/10.

Un anticuerpo monoclonal aislado o anticuerpo scFv, en el que dicho anticuerpo se une a un epítopo en la región del tallo de la proteína hemaglutinina (HA) de un virus de la influenza y neutraliza el virus de la influenza A, donde las secuencias de aminoácidos de las regiones variables de la cadena pesada consisten en FR1 QVQLVQSGAEVKKPGSSVKVSCTSS CDR1 EVTFSSFA FR2 ISWVRQAPGQGLEWLGG CDR2 ISPMFGTP FR3 NYAQKFQGRVTITADQSTRTAYMDLRSLRSEDTAVYYC CDR3 ARSPSYICSGGTCVFDH FR4 WGQGTLVTVSS y las secuencias de aminoácidos de las regiones variables de la cadena ligera consisten en FR1 QPGLTQPPSVSKGLRQTATLTCTGN CDR1 SNNVGNQG FR2 AAWLQQHQGHPPKLLSY CDR2 RNN FR3 DRPSGISERFSASRSGNTASLTITGLQPEDEADYYC CDR3 STWDSSLSAVV FR4 FGGGTKLTVL.

PDF original: ES-2649536_T3.pdf

Método para enriquecer secuencias mutantes monocatenarias a partir de una mezcla de secuencias naturales y mutantes.

(18/10/2017) Un método para preparar una secuencia diana mutante monocatenaria a partir de una mezcla de secuencias diana que se sospecha que contienen la secuencia diana mutante y una secuencia diana natural, el método comprende: (i) someter las secuencias diana a una temperatura de desnaturalización que es superior a la temperatura de fusión de las secuencias diana, formar de esta manera una mezcla que contiene la secuencia mutante monocatenaria y secuencias naturales monocatenarias, la mezcla se caracteriza por una relación de secuencias mutantes monocatenarias con respecto a secuencias naturales monocatenarias, (ii) poner en contacto la mezcla con un exceso de una…

Péptido BAD de dominio BH3 para usar en el tratamiento o retardo de la aparición de la diabetes.

Sección de la CIP Necesidades corrientes de la vida

(26/07/2017). Inventor/es: WALENSKY,LOREN D, KORSMEYER,STANLEY J, DANIAL,NIKA N, BIRD,GREGORY. Clasificación: A61K38/17, A61P3/10.

Un péptido BAD de dominio BH3 de menos de 195 aminoácidos para uso en el tratamiento o retardo del inicio de la diabetes.

PDF original: ES-2637687_T3.pdf

Métodos de tratamiento de una enfermedad asociada a la cinesina meiótica.

Sección de la CIP Necesidades corrientes de la vida

(17/05/2017). Inventor/es: PELLMAN,DAVID. Clasificación: A61P35/00, A61K31/7088, A61K31/7105.

Un agente de iARN que inhibe una cinesina meiótica HSET, para su uso en el tratamiento de una enfermedad o trastorno asociado a la cinesina meiótica, en el que la enfermedad o trastorno asociado a la cinesina meiótica es una enfermedad o un trastorno proliferativo celular.

PDF original: ES-2633930_T3.pdf

Inmunidad tumoral.

Sección de la CIP Necesidades corrientes de la vida

(17/05/2017). Inventor/es: DRANOFF, GLENN, JINUSHI,MASAHISA. Clasificación: A61K39/00, A61P35/00, A61K39/395.

Una composición que comprende un inhibidor de MFG-E8 y GM-CSF, en donde el inhibidor de MFG-E8 interfiere con la unión de MFG-E8 a una integrina o a la fosfatidilserina expresada en la superficie de una célula.

PDF original: ES-2629749_T3.pdf

Descubrimiento de una mutación somática en el gen MYD88 en linfoma linfoplasmocitario.

Sección de la CIP Química y metalurgia

(22/02/2017). Inventor/es: TREON,STEVEN P. Clasificación: C12Q1/68.

Un método in vitro para facilitar el diagnóstico de linfoma linfoplasmocitario en un sujeto, comprendiendo el método: determinar si hay una mutación en la posición 38182641 en el cromosoma 3p22.2 basándose en el genoma de referencia NCBI Compilación 37, en una muestra biológica de un sujeto que tiene una o más de las siguientes características clínicas: anemia, hiperviscosidad, neuropatía, coagulopatías, explenomegalia, hepatomegalia, adenopatía y una paraproteína sérica de IgM, en el que la presencia de la mutación es indicativa de que el sujeto tiene linfoma linfoplasmocitario.

PDF original: ES-2624981_T3.pdf

Péptidos terapéuticos.

Sección de la CIP Necesidades corrientes de la vida

(01/02/2017). Inventor/es: WUCHERPFENNIG, KAI, W., DRANOFF, GLENN, FRANZ,BETTINA, MAY,KENNETH JR, HODI,F. STEPHEN, HARVEY,CHRISTOPHER. Clasificación: A61K39/395.

Una composicion que comprende un anticuerpo o un fragmento de anticuerpo que se unen inmunoespecificamente a la secuencia A relacionada con polipeptido de clase I del CMH (MICA), en la que el anticuerpo o el fragmento de anticuerpo comprenden una region variable de cadena pesada (VH) y una region variable de cadena ligera (VL) y (a) una region determinante de la complementariedad (CDR) 3 expuesta en la SEQ ID NO: 212 de la VH del anticuerpo ID 9; o (b) la region determinante de la complementariedad (CDR) 3 expuesta en la SEQ ID NO: 158 de la VH del anticuerpo ID 6.

PDF original: ES-2619707_T3.pdf

Inhibidores de miristato de moléculas pequeñas de Bcr-abl y métodos de uso.

(16/11/2016) Un compuesto seleccionado de entre lo siguiente: 4-(6-(4-(trifluorometoxi)fenilamino)-5-metilpirimidin-4-il)-N-(2-morfolinoetil)benzamida; 6-(1H-pirrolo[2,3-b]piridin-1-il)-N-(4-(trifluorometoxi)fenil)pirimidin-4-amina; N-(4-(trifluorometoxi)fenil)-6-(1,3,5-trimetil-1H-pirazol-4-il)pirimidin-4-amina; 4-[5-Metil-6-(4-trifluorometoxi-fenilamino)-pirimidin-4-il]-bencenosulfonamida; N-Metil-4-[5-metil-6-(4-trifluorometoxi-fenilamino)-pirimidin-4-il]-bencenosulfonamida; N-Etil-4-[6-(4-trifluorometoxi-fenilamino)-pirimidin-4-il]-bencenosulfonamida; N-(2-Hidroxi-etil)-4-[6-(4-trifluorometoxi-fenilamino)-pirimidin-4-il]-bencenosulfonamida; [6-(4-Metanosulfonil-fenil)-pirimidin-4-il]-(4-trifluorometoxi-fenil)-amina; [6-(4-Metanosulfonil-fenil)-5-metil-pirimidin-4-il]-(4-trifluorometoxifenil)-amina; …

Métodos y composiciones para el tratamiento del cáncer e infecciones persistentes mediante la inhibición de la ruta de la muerte celular 1 (PD-1) programada.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Física

(02/11/2016). Inventor/es: AHMED, RAFI, FREEMAN,GORDAN, SHARPE,ARLENE, DORFMAN,DAVID M, BARBER,DANIEL, WHERRY,E. JOHN. Clasificación: A61K39/00, C07K16/28, G01N33/50, G01N33/574, A61K38/17, A61K31/713.

Un compuesto que reduce la actividad o expresión de un polipéptido de muerte programada (PD-1) para su uso en un método para aliviar o prevenir un síntoma del cáncer en un sujeto, donde dicho compuesto es un anticuerpo contra PD-1, un anticuerpo contra PD-L1, una molécula de ARNi contra PD-1, una molécula de ARNi contra PD-L1, un ARN antisentido contra PD-1, o un ARN antisentido contra PD-L1; donde el cáncer es un linfoma de Hodgkin nodular de predominio linfocítico.

PDF original: ES-2608316_T3.pdf

Uso de anticuerpos anti-EGFR en el tratamiento de enfermedades mediadas por un EGFR mutante.

Sección de la CIP Necesidades corrientes de la vida

(28/09/2016). Inventor/es: SCOTT,ANDREW,MARK, WONG,KWOK-KIN. Clasificación: A61K39/395.

Un anticuerpo mAB806 anti-EGFR o un fragmento de unión al antígeno del mismo para su uso en el tratamiento de un cáncer mediado por el EGFR resistente a un inhibidor de la cinasa de tirosina en un mamífero, en el que dicho cáncer resistente mediado por el EGFR comprende una mutación secundaria T790M en el EGFR.

PDF original: ES-2609094_T3.pdf

Compuestos de tienotriazolodiazepina para tratar una neoplasia.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(14/09/2016). Inventor/es: BRADNER,JAMES ELLIOTT, QI,JUN. Clasificación: A61P35/00, C07D487/04, A61K31/5517, A61K31/551, C07D519/00, C07D495/14, C07D495/12.

Un compuesto representado por una cualquiera de las siguientes formulas estructurales:**Fórmula** y o una sal farmaceuticamente aceptable del mismo, para su uso en el tratamiento de una afeccion seleccionada entre el grupo que consiste en cancer de prostata, carcinoma de celulas renales, hepatoma, carcinoma de pulmon, cancer de mama, cancer de colon, neuroblastoma, glioblastoma multiforme, carcinoma de celulas escamosas que implica una reorganizacion de NUT, carcinoma de linea media de NUT y carcinoma de pulmon de celulas no microciticas.

PDF original: ES-2606958_T3.pdf

Anticuerpos anti-PD-1, PD-L1 y PD-L2 humanos y sus usos.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(22/06/2016). Inventor/es: AHMED, RAFI, CARR, FRANCIS J., FREEMAN, GORDON, J., JONES,TIMOTHY D, GREGSON,JAMES P. Clasificación: A61P35/00, C07K16/28, A61K39/395, A61P31/00.

Un anticuerpo aislado o un fragmento de unión a antígeno del mismo, que comprende: a) una secuencia de región variable de cadena pesada seleccionada del grupo que consiste en las SEQ ID NO: 34-38; y b) una secuencia de región variable de cadena ligera seleccionada del grupo que consiste en las SEQ ID NO: 39- 42, en donde el anticuerpo aislado, o un fragmento de unión a antígeno del mismo, se une a una proteína PD-L1 que tiene la secuencia de aminoácidos de la SEQ ID NO: 4, y el anticuerpo aislado, o el fragmento de unión a antígeno del mismo, está humanizado o es compuesto.

PDF original: ES-2592216_T3.pdf

Procedimientos para la predicción de una respuesta contra el cáncer.

(01/06/2016) Procedimiento para predecir el resultado del tratamiento contra el cáncer de un sujeto con un trastorno hiperproliferativo celular, que comprende determinar una puntuación global de aberraciones cromosómicas (GCAS) mediante: (i) el análisis de una muestra biológica que comprende células tumorales obtenidas del sujeto para determinar si una pluralidad de loci cromosómicos distribuidos a lo largo del genoma muestran una aberración cromosómica seleccionada del grupo que consiste en desequilibrio alélico (NAI), pérdida de heterocigosidad (NLOH), aberraciones en el número de copias (NCNA), ganancia del número de copias (NCNG), disminución del número de copias (NCND) y combinaciones de los mismos, y (ii) la determinación del recuento en todo el genoma de los loci cromosómicos que muestran aberraciones cromosómicas en la muestra biológica…

Péptidos alfa helicoidales adecuados para activar o inhibir la muerte celular.

(04/05/2016) Un polipéptido α-helicoidal adecuado para activar o inhibir la muerte celular de fórmula (I): **Fórmula** en la que: cada R1 y R2 son independientemente H, alquilo C1-C20, alquenilo C2-C20, alquinilo C2-C20, arilalquilo, cicloalquilalquilo, heteroarilalquilo o heterociclilalquilo; R3 es un reticulante que es alquilo C1-C20, alquenilo C2-C20 ó alquinilo C2-C20; donde R3 está sustituido con de 0 a 6 R5; R5 es halógeno, alquilo, OR6, N(R6)2, SR6, SOR6, SO2R6, CO2R6, R6, un epóxido, un resto fluorescente o un radioisótopo; R6 es H, alquilo o un agente terapéutico; x es un número entero seleccionado de 2, 3 ó 6; cada…

Mutaciones de BRAF que confieren resistencia a inhibidores de BRAF.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(30/03/2016). Inventor/es: GARRAWAY,LEVI, EMERY,CAROLINE. Clasificación: C12N9/12, A61K31/4184.

Una molécula de ácido nucleico aislada que codifica un polipéptido de BRAF mutante que tiene una actividad de BRAF, en la que dicho polipéptido de BRAF mutante comprende una secuencia de aminoácidos que tiene al menos una sustitución de aminoácido en comparación con un polipéptido de BRAF V600E (SEQ ID NO: 4), confiriendo la al menos una sustitución de aminoácido resistencia a uno o más inhibidores de BRAF en el polipéptido de BRAF mutante, el inhibidor de BRAF seleccionado de RAF-265 o PLX4720, en el que la al menos una sustitución de aminoácido sucede en una o más posiciones de aminoácidos seleccionadas del grupo que consiste en A29, H72, S113, S124, P162, C194, L227, P231, C251, V291, Q329, K483, L485, T521, V528, D587, P655, S657, S683, P686, C696, L697, P722, F738 y C748.

PDF original: ES-2576061_T3.pdf

Péptidos p53 estabilizados y usos de los mismos.

(09/02/2016) Un polipéptido helicoidal alfa que se une a la proteína doble minuto humana 2 (HDM2) y/o doble minuto humana 4 (HDMX) de Fórmula ,**Fórmula** en donde: cada uno de R1 y R2 es independientemente H, alquilo, alquenilo, alquinilo, arilalquilo, cicloalquilalquilo, heteroarilalquilo, o heterociclilalquilo; cada R3 se extiende a través de dos vueltas helicoidales del polipéptido y es independientemente alquileno, o alquenileno o alquinileno; n es un número entero de 1 a 4; x es 6; y y w son independientemente números enteros de 0 a 100; z es un número entero de 1 a 10; y cada Xaa es independientemente un aminoácido; en donde el polipéptido modificado comprende al menos 8 aminoácidos contiguos de la secuencia Leu1 Ser2 Gln3 Glu4 Thr5 Phe6 Ser7 Asp8 Leu9 Trp10 Lys11 Leu12 Leu13…

NKG2D-Fc para la inmunoterapia.

(29/07/2015) Una composición que comprende unna quimera de NKG2D-Fc y un soporte farmacéuticamente aceptable en donde la quimera de NKG2D-Fc une un ligando de NKG2D, para uso para el tratamiento de un cáncer que expresa el ligando de NKG2D.

PD-1, receptor para la B7-4 y su utilización.

(18/03/2015) Procedimiento para modular una respuesta inmunitaria que comprende poner en contacto in vitro una célula que expresa B7-4, que es un ligando proteico para PD-1 que comprende la secuencia de aminoácidos representada en las figuras 3 o 4, o una proteína que presenta por lo menos un 50 % de identidad de aminoácidos con la secuencia de aminoácidos de B7-4 de longitud completa representada en las figuras 3 o 4, o un inmunocito que expresa PD-1, que es el receptor para B7-4, con una sustancia seleccionada de entre el grupo que comprende B7-4, una proteína que comprende un dominio extracelular de B7-4, PD-1 y anticuerpos anti-B7-4, que modula la interacción de B7-4 con PD-1 para, de este modo, modular la respuesta inmunitaria.

Columnas de cromatografía con emisores de electronebulización integrados.

(04/03/2015) Un método para fabricar una columna de cromatografía, columna de cromatografía que comprende: un tubo de sílice que comprende un extremo ahusado que forma un orificio que tiene un diámetro inferior a 3 micrómetros; una cavidad tubular interior que tiene un diámetro de 75 micrómetros o inferior, y una frita porosa que comprende silicato; en el que la frita porosa se coloca adyacente al extremo ahusado de 1 a 5 mm desde el orificio y tiene una longitud de aproximadamente 1 a 3 mm; método que comprende: (a) obtener un tubo de sílice que comprende dos extremos abiertos y una cavidad tubular interior con un diámetro de 75 micrómetros o inferior que se extiende entre los dos extremos abiertos; (b) depositar una composición líquida de silicato en la cavidad tubular interior del tubo en un…

Composiciones y su uso en el tratamiento de neoplasia, enfermedades inflamatorias y otras enfermedades.

(07/01/2015) Un compuesto representado con una fórmula estructural seleccionada entre el grupo que consiste en:**Fórmula** o una sal farmacéuticamente aceptable de cualquiera de los anteriores.

Métodos de tratamiento de cáncer resistente a agentes terapéuticos de ERBB.

(12/11/2014) Un agente terapéutico anti-ErbB y un agente terapéutico anti-MET para su uso en el tratamiento de un cáncer en un sujeto que ha desarrollado resistencia al tratamiento con un agente terapéutico anti-ErbB, en el que el sujeto tiene una amplificación del gen MET, en el que el agente terapéutico anti-ErbB es gefitinib, erlotinib, lapatinib, PF00299804, CI-1033, EKB-569, BIBW2992, ZD6474, AV-412 o HKI-272, y en el que el agente terapéutico anti-MET es PHA-665.752, SU11274, SU5416, PF-02341066, XL-880 o MGCD265.

Péptidos alfa helicoidales estabilizados y utilizaciones de los mismos.

(04/09/2013) Polipéptido proapoptósico que contiene hélice α para su utilización en el tratamiento de cáncer o enfermedadesneoplásicas, siendo dicho polipéptido de fórmula (III): en la que; cada R1 y R2 son independientemente H, alquilo C1-C20, alquenilo C2-C20, alquinilo C2-10 C20, arilalquilo,cicloalquilalquilo; heteroarilalquilo o heterociclilalquilo; cada n es independientemente un número entero de 1 a 15; x es 2, 3 o 6; cada y es independientemente un número entero de 0 a 100; z es un número entero de 1 a 10; y cada Xaa es independientemente un alfa-aminoácido y es el mismo aminoácido que en el polipéptido proapoptósicoque…

Composiciones para tratar el cáncer usando el inhibidor de proteasomas PS-341.

(03/09/2013) Uso de una cantidad eficaz de PS-341, para la preparación de un medicamento para aumentar lasensibilidad de una célula cancerosa derivada de un sujeto que experimentó recidiva tras la monoterapiacon P S-341, un agente quimioterápico.

Metilación y expresión génicas.

(10/06/2013) Un método para preparar una biblioteca de cariotipado digital específica de metilación (MSDK), comprendiendo el método: proporcionar la totalidad o parte del ADN genómico de una célula de ensayo eucariótica; exponer el ADN a una enzima de restricción de mapeo sensible a la metilación (MMRE) para generar una pluralidad de primeros fragmentos; conjugar a una terminación o a las dos terminaciones de cada uno de los primeros fragmentos un resto de unión, comprendiendo el resto de unión un primer miembro de un par de afinidad, dando lugar la conjugación a una pluralidad de segundos fragmentos; exponer la pluralidad de segundos fragmentos a una enzima de restricción de fragmentación (FRE) para generar una pluralidad de terceros fragmentos, conteniendo cada tercer fragmentos en una terminación el primer miembro del par de afinidad…

Composiciones y métodos para tratar enfermedades neoplásicas.

(26/02/2013) Uso de un compuesto de fórmula (I) o una sal farmacéuticamente aceptable de éste: 0en la preparación de un medicamento para tratar una enfermedad neoplásica que es resistente a bortezomib,dexametasona o talidomida, en el que X se selecciona del grupo que consiste en flúor, cloro, bromo o yodo.

1 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015