CIP 2015 : C07K 16/28 : contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.

CIP2015 > C > C07 > C07K > C07K 16/00 > C07K 16/28[2] > contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.
Notas[t] desde C01 hasta C14: QUIMICA
C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).
C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales.
C07K 16/28 · · contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.

CIP2015: Invenciones publicadas en esta sección.

  1. 1.-

    Un método in vitro para enriquecer una población de células madre de tumor sólido, que comprende las etapas de: (a) disociar un tumor sólido de cáncer epitelial; (b) poner en contacto las células disociadas con un primer reactivo que se une a CD44 y un segundo reactivo que se une a CD24; y (c) seleccionar células que se unen al primer reactivo y que no se unen de manera detectable o que se unen débilmente al segundo reactivo, en donde las células seleccionadas están enriquecidas en células madre tumorales.

  2. 2.-


  3. 3.-

    Un anticuerpo monoclonal humano, o una porción de unión a antígeno del mismo, que se une específicamente a CXCR4 humano nativo expresado sobre una superficie celular y comprende: una CDR1 de la región variable de la cadena pesada que comprende aminoácidos que tienen la secuencia expuesta en SEC ID Nº: 1; una CDR2 de la región variable de la cadena pesada que comprende aminoácidos que tienen la secuencia expuesta en SEC ID Nº: 5; una CDR3 de la región variable de la cadena pesada que comprende aminoácidos que tienen la secuencia...

  4. 4.-

    Un agente que comprende o consiste en un anticuerpo con especificidad para la proteína accesoria del receptor de interleucina 1 (IL1RAP) para su uso en el tratamiento de una leucemia, siendo el agente capaz de inducir citotoxicidad mediada por células dependientes de anticuerpos (ADCC) de hemocitoblastos patológicos y/o células progenitoras asociadas a una leucemia, en donde las células expresan la IL1RAP.

  5. 5.-

    Anticuerpo aislado ligante de IL-18R1 humana y caracterizado por que comprende como las CDR de región variable de cadena pesada una región CDRH1 de secuencia SEC ID nº 2 ó SEC ID nº 10, una región CDRH2 de secuencia SEC ID nº 3 y una región CDRH3 de secuencia SEC ID nº 4, y como CDR de región variable de cadena ligera, una región CDRL1 de secuencia SEC ID nº 6, una región CDRL2 de secuencia SEC ID nº 7 y una región CDRL3 de secuencia SEC ID nº 8.

  6. 6.-

    Célula huésped de levadura transformada que comprende un ADNc que codifica para la proteína HAC1 activada de levadura y un gen de RRBP1 de humano o perro, en la que la célula huésped transformada comprende un gen que codifica para una proteína heteromultimérica foránea, en la que la proteína heteromultimérica es un anticuerpo o un fragmento funcional del mismo.

  7. 7.-

    Un anticuerpo biespecífico CD19xCD3 para uso en un método para tratar linfocitos positivos para CD19 malignos en un paciente humano, dicho paciente tiene una proporción de células B:T de aproximadamente 1:5 o menor, dicho método comprende: (a) administrar una primera dosis de un anticuerpo biespecífico CD19xCD3 durante un primer periodo de tiempo; y consecutivamente (b) administrar una segunda dosis de dicho anticuerpo durante un segundo periodo de tiempo; en donde dicha segunda dosis supera dicha primera dosis.

  8. 8.-

    Anticuerpo anti-NR10 que es uno cualquiera de: un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H30, H44) y una región variable de cadenaligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 196, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H28, H42) y una región variable de cadena...

  9. 10.-

    Un anticuerpo aislado o uno de sus fragmentos activos, en donde dicho anticuerpo aislado o fragmento activo del mismo: (a) se une a EGFR de tipo salvaje humano unido a la célula cuando el gen EGFR es amplificado; (b) se une a de2-7 EGFR en un epítopo distinto del péptido de empalme LEEKKGNYVVTDH; (c) no se une a células de tipo salvaje que expresan EGFR endógeno; (d) reconoce un epítopo dentro de la secuencia de residuos 273-501 del EGFR de tipo salvaje humano

  10. 12.-

    Procedimiento para producir, en una levadura, un anticuerpo de dominio capaz de formar una unidad de unión a antígeno única y caracterizado por un nivel reducido o ausencia de una variante de anticuerpo de dominio que carece de al menos un enlace disulfuro, que comprende I) aplicar condiciones que promuevan la formación de puentes disulfuro en anticuerpos de dominio, o II) retirar los anticuerpos de dominio que carecen de al menos un puente disulfuro aplicando condiciones seleccionadas de i) unión de anticuerpos de dominio que comprenden grupos tiol libres a grupos reactivos adecuados, opcionalmente en condiciones desnaturalizantes; y ii) cromatografía de alta resolución en fase inversa, o III) una combinación de (I) y...

  11. 13.-

    Polipéptido anti-TNF-alfa que comprende al menos un anticuerpo de dominio simple anti-TNF-alfa que comprende (a) una secuencia representada por SEQ ID NO: 1, o (b) una secuencia homóloga que presenta una identidad de secuencia de más del 85% con la secuencia original representada por SEQ ID NO: 1; en el que dicha secuencia homóloga contiene los residuos de FR2 hidrófobos que se encuentran normalmente en anticuerpos convencionales de origen humano y un residuo de arginina en la posición 103 (numeración según Kabat).

  12. 14.-

    Un anticuerpo aislado que comprende una cadena pesada y una cadena ligera, en el que (a) la cadena pesada comprende una región variable de cadena pesada que comprende las tres regiones determinantes de complementariedad (CDR) de la secuencia de aminoácidos de la SEC ID Nº: 1, en la que la HCDR1 comprende SYVMH, la HCDR2 comprende YINPYNGGTQYNEKFKG y la HCDR3 comprende RTFPYYFDY; y una región constante de cadena pesada que comprende la secuencia de aminoácidos de la SEC ID Nº: 9, en la que la región bisagra de la región constante de cadena pesada comprende al menos...

  13. 16.-

    Una composición farmacéutica que comprende un anticuerpo monoclonal anti-CD19 quimerizado, o humanizado que (a) es del isotipo humano IgG1 o IgG3, o (b) media la citotoxicidad humana celular dependiente de anticuerpo (ADCC), en un vehículo farmacéuticamente aceptable, en la que el anticuerpo comprende las secuencias expuestas como los aminoácidos 33 a 37, los aminoácidos 51 a 68 y los aminoácidos 101 a 115 de la SEC ID Nº 2 y las secuencias expuestas como los aminoácidos 43 a 58, los aminoácidos 74 a 80 y los aminoácidos 113 a 121 de la SEC ID Nº 16, o las secuencias expuestas como los aminoácidos 33 a 37, los aminoácidos 51 a 68 y los aminoácidos 101 a 114...

  14. 18.-

    Un anticuerpo monoclonal de c-Met, o fragmento de unión a antígeno del mismo, que comprende tres regiones determinantes de la complementariedad de la cadena ligera (LCDR) y tres regiones determinantes de la complementariedad de la cadena pesada (HCDR), en el que LCDR1 comprende la secuencia de aminoácidos SVSSSVSSIYLH (SEC ID Nº 53) , LCDR2 comprende la secuencia de aminoácidos STSNLAS (SEC ID Nº 54), LCDR3 comprende la secuencia de aminoácidos QVYSGYPLT (SEC ID Nº 56), HCDR1 comprende la secuencia de aminoácidos GYTFTDYYMH (SEC ID Nº 65), HCDR2 comprende la secuencia de aminoácidos RVNPNRRGTTYNQKFEG (SEC ID Nº 68), y HCDR3 comprende la secuencia de aminoácidos...

  15. 19.-

    Un complejo de a) un anticuerpo biespecífico específico contra digoxigenina y una proteína diana, que comprende un primer sitio de unión al antígeno que se une a digoxigenina y un segundo sitio de unión al antígeno que se une a una proteína diana, y b) digoxigenina, en el que la digoxigenina está conjugada a un agente terapéutico o de diagnóstico seleccionado del grupo que consiste en un péptido, un compuesto pequeño, un compuesto pequeño radiactivamente marcado y un reactivo de obtención de imágenes, en el que dicho...

  16. 20.-

    Un anticuerpo aislado o una proteína funcional que comprende una porción de unión a antígeno de un anticuerpo para una SEQ ID NO: 87 de polipéptido de BAFFR diana, caracterizado porque el anticuerpo o proteína funcional comprende (i) un polipéptido VH que tiene al menos 90 por ciento de identidad de secuencia con al menos una de SEQ ID NOs: 50 - 56 y una secuencia del polipéptido VL que tiene al menos 90 por ciento de identidad de secuencia con al menos una de SEQ ID NOs: 43 a 49 y (ii) una secuencia de aminoácidos de CDR3 de la región variable de cadena pesada seleccionada del grupo que consiste en SEQ ID NOs: 16-21 o una secuencia de aminoácidos que tiene...

  17. 22.-

    Un anticuerpo anti-NR10/IL-31RA que tiene actividad neutralizante de NR10/IL-31RA para su uso para prevenir o tratar una enfermedad inflamatoria, en el que la enfermedad inflamatoria es dermatitis atópica, reumatismo u osteoartritis, y en el que el anticuerpo se une y neutraliza el NR10/IL-31RA humano y el NR10/IL-31RA de mono cynomolgus, en el que el anticuerpo presenta: (i) una región variable de cadena pesada que es codificada por un ácido nucleico que se hibrida bajo condiciones rigurosas con el ácido nucleico que codifica la secuencia de aminoácidos de SEQ ID NO:16; (ii)...

  18. 23.-

    Una composición farmacéutica que comprende un receptor FZD8 soluble y un vehículo, excipiente y/o estabilizante farmacéuticamente aceptable, en donde la secuencia de aminoácidos del receptor FZD8 soluble consiste en los restos 28 a 158 de la SEC ID Nº 7, unida a una secuencia de no receptor FZD, en donde la secuencia de no receptor FZD comprende un Fc humano.

  19. 24.-

    Un polipéptido aislado que comprende: (a) una secuencia de aminoácidos idéntica a una secuencia de aminoácidos de referencia excepto porque al menos un residuo de cisteína de dicha secuencia de aminoácidos de referencia está sustituido por un aminoácido diferente, en el que dicha secuencia de aminoácidos de referencia se elige de entre el grupo que consiste en: (i) los aminoácidos a hasta 445 del ID. SEC. Nº: 49, (ii) los aminoácidos 27 hasta b del ID. SEC. Nº: 49, y (iii) los aminoácidos a hasta b del ID. SEC. Nº: 49, en los que a es cualquier número entero desde 25 hasta 35 y b es cualquier número entero desde 300 hasta 450; y (b) un polipéptido...

  20. 25.-

    Composiciones farmacéuticas y uso para preparar un medicamento destinado al tratamiento de la obesidad, los trastornos metabólicos relacionados y la adicción a substancias psicoactivas. La presente invención proporciona composiciones farmacéuticas que constan de una forma activada y potenciada de un anticuerpo para el receptor canabinoide humano y su uso en el tratamiento de la obesidad y trastornos metabólicos relacionados. La presente invención proporciona asimismo composiciones farmacéuticas que constan de una forma activada y potenciada de un anticuerpo para el receptor...

  21. 26.-

    Un anticuerpo monoclonal humano aislado o una porción de enlace a antígeno del mismo que se enlazan específicamente a PD-L1, que comprende: (a) una región variable de cadena pesada CDR1 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 22; (b) una región variable de cadena pesada CDR2 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 32; (c) una región variable de cadena pesada CDR3 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 42; (d) una región variable de cadena ligera CDR1 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 52; (e) una...

  22. 28.-

    Un dominio variable único de inmunoglobulina anti-receptor TNFα tipo 1 que comprende la siguiente secuencia de aminoácidos: EVQLLESGGGLVQPGGSLRLSCAASGFTFAHETMVWVRQAPGKGLEWV SHIPPDGQDPFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCAL LPKRGPWFDYWGQGTLVTVSS

  23. 29.-

    Un anticuerpo aislado, o un fragmento de unión a antígeno del mismo, que comprende: una región determinante de complementariedad 1 (CDR1 de VH) de la región variable de cadena pesada (VH) que comprende la secuencia de aminoácidos mostrada en la SEC ID Nº 3; una región determinante de complementariedad 2 (CDR2 de VH) de la región variable de cadena pesada (VH) que comprende la secuencia de aminoácidos mostrada en la SEC ID Nº 4; una región determinante de complementariedad 3 (CDR3 de VH) de la región variable de cadena pesada (VH) que comprende la secuencia de aminoácidos mostrada en la SEC ID Nº 5; una región determinante de complementariedad 1 (CDR1 de VL) de la región variable...

  24. 30.-

    Anticuerpos anti-FGFR3 y métodos que emplean los mismos

    . Solicitante/s: GENENTECH, INC.. Inventor/es:

    Un anticuerpo anti-FGFR3 antagonista aislado, en donde el anticuerpo comprende HVR-L1 que comprende la secuencia RASQDVDTSLA (SEQ ID NO: 87), HVR-L2 que comprende la secuencia SASFLYS (SEQ ID NO: 88), HVR-L3 que comprende la secuencia QQSTGHPQT (SEQ ID NO: 89), HVR-H1 que comprende la secuencia GFTFTSTGIS (SEQ ID NO: 84), HVR-H2 que comprende la secuencia GRIYPTSGSTNYADSVKG (SEQ ID NO: 85), y HVR-H3 que comprende la secuencia ARTYGIYDLYVDYTEYVMDY (SEQ ID NO: 86).

  25. 31.-

    Una molécula de anticuerpo aislada que se une al TSHR para estimular al TSHR, comprendiendo la molécula de anticuerpo un dominio VL de anticuerpo que comprende SEC ID Nº:24 para CDR I, SEC ID Nº:25 para CDR II y SEC ID Nº:26 para CDR III y un dominio VH de anticuerpo que comprende SEC ID Nº:6 para CDR I, SEC ID Nº:7 para CDR II y SEC ID Nº:8 para CDR III.

  26. 32.-

    Uso de anticuerpos de interleuquina-4 y composiciones de los mismos

    . Solicitante/s: IMMUNEX CORPORATION. Inventor/es:

    Un anticuerpo monoclonal humano capaz de inhibir una actividad biológica inducida por IL-4 que compite con un anticuerpo de referencia para la unión a una célula que expresa el receptor de IL-4 (IL-4R) humano, en el que: a) la cadena ligera del anticuerpo de referencia comprende la secuencia de SEQ ID NO:10 y la cadena pesada del anticuerpo de referencia comprende la secuencia de SEQ ID NO:12; o b) la cadena ligera del anticuerpo de referencia comprende la secuencia de SEQ ID NO:14 y la cadena pesada del anticuerpo de referencia comprende la secuencia de SEQ ID NO:16; o c) la cadena ligera del anticuerpo de referencia comprende la secuencia de SEQ ID NO:18 y la cadena pesada del anticuerpo de referencia comprende la secuencia de SEQ ID NO:20; o d) la cadena ligera del anticuerpo de referencia comprende la secuencia de SEQ ID NO:22 y la cadena pesada del anticuerpo de referencia comprende la secuencia de SEQ ID NO:24.

1 · > · 3 · 5 · 10 · >>