CIP 2015 : C07K 16/28 : contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.

CIP2015CC07C07KC07K 16/00C07K 16/28[2] › contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C07 QUIMICA ORGANICA.

C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales.

C07K 16/28 · · contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.

CIP2015: Invenciones publicadas en esta sección.

Agentes de ligación a TLR3.

(02/01/2019). Solicitante/s: Innate Pharma. Inventor/es: GAUTHIER, LAURENT, MOREL,YANNIS, PATUREL,CARINE, BONNAFOUS,CÉCILE, PERROT,IVAN.

Un anticuerpo monoclonal que inhibe la señalización mediada por TLR3 en una célula que expresa TLR3, en donde el anticuerpo se liga a la superficie lateral sin glicano de la porción N-terminal del polipéptido TLR3, en donde dicho anticuerpo tiene una ligación reducida en más de un 40% a un polipéptido TLR3 mutante que comprende una mutación en los residuos 137 a 139 del polipéptido TLR3 de SEQ ID NO: 1, respecto a la ligación entre el anticuerpo y un polipéptido TLR3 de tipo natural de SEQ ID NO: 1.

PDF original: ES-2695151_T3.pdf

Dominio de unión específico entre especies.

(28/12/2018). Solicitante/s: Amgen Research (Munich) GmbH . Inventor/es: KUFER, PETER, RAUM, TOBIAS, HOFFMANN,PATRICK, KLINGER,MATTHIAS, RAU,DORIS, MANGOLD,SUSANNE, KISCHEL,ROMAN, LUTTERBÜSE,RALF.

Un polipéptido que comprende un dominio de unión, que es un anticuerpo capaz de unirse a un epítopo de la cadena CD3ε humana y de Callithrix jacchus, Saguinus oedipus o Saimiri sciureus, en donde el epítopo es parte de una secuencia de aminoácidos comprendida en el grupo que consiste en SEQ ID NOs:2, 4, 6, u 8 y comprende al menos la secuencia de aminoácidos Gln-Asp-Gly-Asn-Glu, en donde el primer dominio de unión comprende una región VL que comprende CDR-L1 GSSTGAVTSGNYPN (SEQ ID NO:153), CDR-L2 GTKFLAP (SEQ ID NO:154) y CDR-L3 VLWYSNRWV (SEQ ID NO:155) y una región VH que comprende CDR-H 1 KYAMN (SEQ ID NO:174), CDR-H2 RIRSKYNNYATYYADSVKD (SEQ ID NO:175) y CDR-H3 HGNFGNSYISYWAY (SEQ ID NO:176), y en donde el polipéptido comprende además un segundo dominio de unión capaz de unirse a un antígeno de la superficie celular que es CD33.

PDF original: ES-2695047_T3.pdf

Combinaciones antitumorales que contienen anticuerpos que reconocen específicamente CD38 y bortezomib.

(27/12/2018). Solicitante/s: SANOFI. Inventor/es: LEJEUNE,Pascale, DECKERT,JUTTA, MAYO,MICHELE F, PARK,PETER U.

Una combinación farmacéutica que comprende un anticuerpo humanizado que reconoce específicamente CD38 y al menos bortezomib, en donde dicho anticuerpo es capaz de destruir una célula CD38+ por apoptosis, citotoxicidad mediada por célula dependiente de anticuerpo (ADCC) y citotoxicidad dependiente de complemento (CDC), y en donde dicho anticuerpo comprende al menos una cadena pesada y al menos una cadena ligera, en donde dicha cadena pesada comprende la secuencia de aminoácidos SEQ ID NO: 66, y en donde dicha cadena ligera comprende una secuencia de aminoácidos que consiste en las SEQ ID NOS: 62 o 64.

PDF original: ES-2694784_T3.pdf

Smoothened mutante y métodos de uso de la misma.

(27/12/2018). Solicitante/s: GENENTECH, INC.. Inventor/es: DE SAUVAGE, FREDERIC, J., YAUCH,ROBERT,L, DIJKRAAF,GERRIT J.P, SHARPE,HAYLEY.

Una molécula de ácido nucleico aislada que codifica una proteína SMO mutante que comprende una secuencia de aminoácidos que es idéntica en al menos el 95 % a la SEQ ID NO: 1 en donde la secuencia de aminoácidos comprende un aminoácido distinto del triptófano en la posición de aminoácido que corresponde a la posición 281 de la SEQ ID NO: 1.

PDF original: ES-2694857_T3.pdf

Conjugados de anticuerpos multifuncionales.

(26/12/2018). Solicitante/s: Pfizer Healthcare Ireland. Inventor/es: LEE,ALICE, TUMELTY,DAVID, LAURENT,OLIVIER ALEXANDRE, BHAT,ABHIJIT SURESH, BRADSHAW,CURT WILLIAM, PRESTON,RICHARD RYAN, WOOD,LAUREN DIANE, YU,WEI HONG.

Un procedimiento de preparación de un conjugado de anticuerpo multifuncional (MAC), comprendiendo el MAC: (i) un anticuerpo o porción de unión a antígeno del mismo, que comprende al menos un fragmento de una región kappa constante de cadena ligera (CLκ) que comprende K188 y H189 según la numeración de Kabat; (ii) un enlazador que comprende la fórmula X-Y-Z, en la que Z es un grupo de fórmula y está covalentemente conectado al anticuerpo a través del grupo ε-amino de la cadena lateral de K188 (según la numeración de Kabat), Y es una cadena de conexión compatible biológicamente, lineal o ramificada, y X es un grupo conectado covalentemente a al menos una fracción efectora, comprendiendo el procedimiento unir covalentemente la fracción efectora a un enlazador que termina en un éster activado con un grupo saliente Z * de fórmula: en la que R1 es F, y h = 3, 4 o 5, y hacer reaccionar el complejo fracción efectora-enlazador-Z * así formado con el anticuerpo.

PDF original: ES-2704223_T3.pdf

Anticuerpos anti-Tie2 y usos de los mismos.

(20/12/2018). Solicitante/s: REGENERON PHARMACEUTICALS, INC.. Inventor/es: THURSTON, GAVIN.

Un anticuerpo humano aislado que se une específicamente a Tie2 humana e inhibe la señalización mediada por Tie2, en el que el anticuerpo comprende las regiones variables de las cadenas pesada y ligera del anticuerpo producido a partir de una estirpe celular depositada en la American Type Culture Collection (Colección Americana de Cultivos Tipo) con el número de acceso PTA 12295 y una región constante de IgG4 humana.

PDF original: ES-2694411_T3.pdf

Anticuerpos anti-ErbB3 y usos de los mismos.

(18/12/2018). Solicitante/s: REGENERON PHARMACEUTICALS, INC.. Inventor/es: DALY,CHRISTOPHER, MACDONALD,DOUGLAS, DUAN,XUNBAO.

Un anticuerpo aislado, o fragmento de unión a antígeno del mismo, que se une específicamente a ErbB3, en el que el anticuerpo o fragmento de unión a antígeno comprende: (a) una región variable de cadena pesada (HCVR) que tiene la secuencia de aminoácidos de la SEQ ID NO: 322; y (b) una región variable de cadena ligera (LCVR) que tiene la secuencia de aminoácidos de la SEQ ID NO: 330.

PDF original: ES-2694153_T3.pdf

Anticuerpo anti-fosfolipasa D4.

(18/12/2018). Solicitante/s: SBI BIOTECH CO., LTD. Inventor/es: CHO,MINKWON, ISHIDA,KOJI, YAMAZAKI,TOMOHIDE, ENDO,MAYUKI.

Un anticuerpo monoclonal o un fragmento de anticuerpo que contiene una región de unión a antígeno del mismo que se une a la proteína fosfolipasa D4 humana (PLD4) en una célula dendrítica plasmocitoide.

PDF original: ES-2694165_T3.pdf

Citocinas de haz alfa-helicoidal mutantes dirigidas.

(18/12/2018). Solicitante/s: VIB VZW. Inventor/es: UZE, GILLES, TAVERNIER,JAN, CARTRON,GUILLAUME, PAUL,FRANCIANE, PIEHLER,JACOB.

Una construcción de direccionamiento, que comprende un interferón alfa 2 humano mutante acoplado a un resto de direccionamiento, donde el interferón alfa 2 mutante humano está mutado en uno o más aminoácidos de la región 144-154 y tiene una afinidad reducida por su receptor de interferón y un actividad biológica reducida de menos del 70 % de la actividad biológica del interferón de tipo silvestre, y donde el resto de direccionamiento comprende un dominio variable de anticuerpos de cadena pesada de camélido (VHH) dirigidos a Her2, DC-STAMP, PD-L2 o CD20.

PDF original: ES-2694180_T3.pdf

Polipéptido que comprende una región Fc de IgG1 humana variante.

(17/12/2018). Solicitante/s: GENENTECH, INC.. Inventor/es: PRESTA, LEONARD, G..

Una variante de un polipéptido original que comprende una región Fc de IgG1 humana, variante que se une a un receptor gamma de Fc III (FcγRIII) con mejor afinidad que el polipéptido original, y donde la variante comprende una región Fc de IgG1 humana variante con al menos una modificación de aminoácido en una cualquiera o más de las posiciones de aminoácido 256, 290, 298, 312, 326, 330, 333, 334, 360 o 430 de la región Fc, donde la numeración de los residuos de la región Fc corresponde al índice EU de Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed., Public Health Service, National Institutes of Health, Bethesda, MD.

PDF original: ES-2694002_T3.pdf

Composiciones y métodos para el tratamiento y el diagnóstico del cáncer.

(17/12/2018). Solicitante/s: ONCOMED PHARMACEUTICALS, INC. Inventor/es: GURNEY, AUSTIN.

Una molécula de inmunoglobulina aislada que se une específicamente a un dominio extracelular de una proteína humana de receptor acoplado a proteína G que contiene repeticiones ricas en leucina (LGR), o a una proteína Respondina (RSPO) humana y que es capaz de inhibir el crecimiento de un tumor sólido alterando la unión de una proteína RSPO humana a una proteína LGR humana; en donde la unión específica de la molécula de inmunoglobulina es a través de al menos un sitio de reconocimiento de antígeno dentro de una región variable de la molécula de inmunoglobulina; y en donde la molécula de inmunoglobulina es monoclonal; y en donde la proteína LGR es LGR4, LGR5 o LGR6.

PDF original: ES-2694018_T3.pdf

Anticuerpos terapéuticos.

(13/12/2018). Solicitante/s: NOVO NORDISK A/S. Inventor/es: ZAHN,Stefan, KJæRGAARD,Kristian, ZEUTHEN,LOUISE HJERRILD, HANSEN,ANKER JON, LUND,SØREN.

Un anticuerpo que se une al segundo bucle extracelular de C5aR humano, en donde la región variable de la cadena pesada de dicho anticuerpo comprende una secuencia de CDR1, una de CDR2 y una de CDR3, en donde dichas secuencias de CDR comprenden las secuencias SEQ ID 9, 10 y 11, y en donde la región variable de la cadena ligera de dicho anticuerpo comprende una secuencia de CDR1, una de CDR2 y una de CDR3, en donde dichas secuencias de CDR comprenden las secuencias SEQ ID 13, 14 y 15, en donde la región variable de la cadena pesada de dicho anticuerpo comprende una secuencia al menos un 90 % idéntica a la SEQ ID NO: 12, en donde la región variable de la cadena ligera de dicho anticuerpo comprende una secuencia al menos un 90 % idéntica a la SEQ ID NO: 16, y en donde el anticuerpo tiene una región bisagra Fc de isotipo IgG1.

PDF original: ES-2693647_T3.pdf

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(12/12/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Anticuerpo apto para unirse a cMet, o uno de sus fragmentos divalentes de unión a antígeno caracterizado por que el anticuerpo comprende una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 4, 5 y 6; y una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 13, 11 y 14.

PDF original: ES-2693542_T3.pdf

Anticuerpo que se une a CD3 humano.

(12/12/2018). Solicitante/s: Merus N.V. Inventor/es: BAKKER,ALEXANDER,BERTHOLD,HENDRIK, VAN LOO,PIETER FOKKO.

Un anticuerpo que se une a CD3 humano cuyo anticuerpo comprende una cadena pesada y una cadena ligera en donde dicha cadena pesada comprende una región variable que comprende la secuencia de aminoácidos:**Fórmula** con 0-5 sustituciones de aminoácidos en una o más posiciones distintas de la posición indicada por X1X2 y distintas de las regiones CDR; en donde X1 ≥ N y X2 ≥ A; X1 ≥ N y X2 ≥ T; X1 ≥ H y X2 ≥ G; X1 ≥ D y X2 ≥ G; o X1 ≥ H y X2 ≥ A; y dicha cadena ligera comprende la región variable de la cadena ligera O12/IgVκ 1-39 de la figura 23A con 0-5 sustituciones de aminoácidos.

PDF original: ES-2693596_T3.pdf

Politerapia de un anticuerpo CD20 afucosilado con un conjugado de anticuerpo CD22-fármaco.

(11/12/2018). Solicitante/s: F. HOFFMANN-LA ROCHE AG. Inventor/es: KLEIN, CHRISTIAN, DR., UMANA,PABLO, POLSON,ANDREW, LANG,SABINE.

Obinutuzumab, para su uso en el tratamiento del cáncer en combinación con el conjugado de anticuerpo CD22-fármaco anti-CD22-MC-vc-PAB-MMAE, en el que el anticuerpo anti-CD22 en dicho conjugado de anticuerpo CD22-fármaco comprende el dominio variable de la cadena ligera de SEQ ID NO: 50 y el dominio variable de la cadena pesada de SEQ ID NO: 51.

PDF original: ES-2693370_T3.pdf

Agente terapéutico que induce citotoxicidad.

(10/12/2018) Un complejo polipeptídico que comprende: un dominio de unión al antígeno canceroso; uno cualquiera de los dominios Fc de las SEQ ID NOs: 23, 24, 25 y 26 en el que se muta un aminoácido(s) que forma(n) el dominio Fc, en donde el mutante del dominio Fc ha reducido la actividad de unión al receptor Fcγ por dicha mutación en comparación con el complejo polipeptídico de control que comprende el dominio Fc del mismo isotipo seleccionado de SEQ ID NOs: 23, 24, 25 y 26, y en donde el mutante del dominio Fc ha reducido la actividad de unión a FcγRI, FcγRIIA, FcγRIIB, FcγRIIIA, y/o FcγRIIIB; y un dominio de unión a CD3, en donde el dominio de unión a antígeno y el dominio de unión a CD3 son cada uno un Fab monovalente, y en donde (i) el fragmento Fv de cadena pesada…

Anticuerpos IgG biespecíficos como acopladores de células T.

(05/12/2018). Solicitante/s: Merus N.V. Inventor/es: LOGTENBERG, TON, BAKKER,ALEXANDER,BERTHOLD,HENDRIK, VAN LOO,PIETER FOKKO.

Un anticuerpo IgG biespecífico humano de longitud completa, en donde dicho anticuerpo IgG biespecífico comprende un brazo que reconoce específicamente CLEC12A y un segundo brazo que reconoce específicamente CD3, y en donde el brazo que reconoce específicamente CLEC12A comprende una secuencia variable de cadena pesada que consiste en una secuencia que es idéntica a QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGG STSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAKGTTGDWFDYWGQGT LVTVSS; o una secuencia variable de cadena pesada que consiste en una secuencia que es idéntica a **Fórmula** y en donde ambos brazos comprenden una cadena ligera común que comprende una secuencia variable de cadena ligera que consiste en una secuencia que es idéntica a **Fórmula**.

PDF original: ES-2692951_T3.pdf

Tratamientos para la fibrosis.

(05/12/2018). Solicitante/s: Singapore Health Services Pte Ltd. Inventor/es: COOK,STUART ALEXANDER, SCHAEFER,SEBASTIAN.

Un anticuerpo que es capaz de unirse a la interleucina 11 (IL-11) o al receptor α de IL-11 (IL-11Rα) y de inhibir la señalización mediada por IL-11, para su uso en un método de tratamiento o de prevención de la fibrosis en un ser humano.

PDF original: ES-2692773_T3.pdf

Anticuerpo anti-cMet y su utilización para la detección y el diagnóstico del cáncer.

(04/12/2018) Anticuerpo, o fragmento funcional o derivado del mismo, apto para unirse a c-Met, estando dicho anticuerpo caracterizado por que se selecciona de entre el grupo que consiste en: a) un anticuerpo, o un fragmento funcional o derivado del mismo, que comprende: - una cadena pesada que comprende las tres CDR siguientes como se define según IMGT, respectivamente CDR-H1 que presenta la secuencia SEC ID nº 7, CDR-H2 que presenta la secuencia SEC ID nº 2 y CDR-H3 que presenta la secuencia SEC ID nº 8, y - una cadena ligera que comprende las tres CDR siguientes como se define según IMGT, respectivamente CDR-L1 que presenta la secuencia SEC ID nº 4, CDR-L2 que presenta la secuencia SEC ID nº 5 y CDR-L3 que presenta la secuencia SEC ID nº 6; y b) un anticuerpo, o un fragmento funcional o derivado del…

Proteínas de enlace al antígeno del receptor de oncastatina.

(04/12/2018) Una proteína de unión al antígeno del receptor de oncostatina M (OSMR), en la que la proteína de unión al antígeno es un anticuerpo, en el que el anticuerpo comprende: un dominio variable de cadena ligera que comprende una región 1 determinante de complementariedad de cadena ligera (LCDR1) que tiene la secuencia expuesta en la SEQ ID NO:31; una región 2 determinante de complementariedad de cadena ligera (LCDR2) que tiene la secuencia expuesta en la SEQ ID NO:34; y una región 3 determinante de complementariedad de cadena ligera (LCDR3) que tiene la secuencia expuesta en la SEQ ID NO:37; y un dominio variable de cadena pesada que comprende una región 1 determinante de complementariedad de cadena pesada (HCDR1) que tiene la secuencia expuesta en la SEQ ID NO:13; una región 2 determinante de complementariedad de cadena…

Método para tratar trastornos metabólicos.

(04/12/2018) Una composición que comprende un anticuerpo antagonista que se une a ActRIIB para uso en el tratamiento de un trastorno metabólico en un sujeto, en la que el anticuerpo anti-ActRIIB aumenta el tejido adiposo marrón sin aumentar los niveles de glóbulos rojos en dicho sujeto y en el que el anticuerpo anti-ActRIIB comprende una CDR1 de la región variable de la cadena pesada de la SEQ ID NO: 9; una CDR2 de la región variable de la cadena pesada de la SEQ ID NO: 23; una CDR3 de la región variable de la cadena pesada de la SEQ ID NO: 37; una CDR1 de la región variable de la cadena ligera de la SEQ ID NO: 51; una CDR2 de la región variable…

Variantes de Fc de anticuerpo.

(03/12/2018). Solicitante/s: ROCHE GLYCART AG. Inventor/es: KUBBIES,MANFRED, SCHLOTHAUER,Tilman, BAEHNER,MONIKA, MOESSNER,EKKEHARD, JENEWEIN,STEFAN.

Anticuerpo o proteína de fusión de Fc que comprende una Fc variante de una región Fc de IgG1 humana de tipo salvaje, en el que la Fc variante de la región Fc de IgG1 humana de tipo salvaje contiene las sustituciones de aminoácidos P329G, L234A 5 y L235A, donde los residuos están numerados según el índice EU de Kabat.

PDF original: ES-2692268_T3.pdf

Anticuerpo anti-FOLR1.

(28/11/2018) Anticuerpo monoclonal o fragmento de anticuerpo del mismo que compite con un anticuerpo seleccionado de entre los (a) a (c) siguientes para reconocer específicamente el FOLR1 humano y que se une a un epítopo idéntico al epítopo sobre el FOLR1 humano al que se une el anticuerpo que se encuentra en las posiciones 55 a 62 en la secuencia de aminoácidos de FOLR1 humano representada por la SEC ID nº 1 y que muestra asimismo una actividad antitumoral: (a) un anticuerpo en el que las regiones determinantes de complementariedad (a las que se hace referencia en adelante como CDR) 1 a 3 de cadena pesada (a la que se hace referencia en adelante como cadena H) del anticuerpo comprenden las secuencias de aminoácidos representadas por las SEC ID…

Anticuerpo anti-CDH3 que tiene alta capacidad de internalización.

(21/11/2018). Solicitante/s: Perseus Proteomics Inc. Inventor/es: ISHII,KEISUKE, MITOMO,KATSUYUKI, SUDO,YUKIO, KATSUMI,KEIKO, MATSUURA,TADASHI, KOUDA,KATSUSHI.

Anticuerpo monoclonal IgG anti-p-cadherina, en el que el anticuerpo se produce mediante un hibridoma depositado con el número de registro NITE BP-988 o NITE BP-1145, o en el que el anticuerpo se produce mediante una célula depositada con el número de registro NITE BP-1147 o NITE BP-1148.

PDF original: ES-2690469_T3.pdf

Anticuerpos monoclonales anti-VAP-1 completamente humanos.

(20/11/2018). Solicitante/s: BIOTIE THERAPIES LTD. Inventor/es: SMITH, DAVID JOHN, VAINIO, PETRI, MIKKOLA,JARI, VUORIO,PÄIVI, VAINIO,JANI.

Un anticuerpo anti-VAP-1 o un fragmento de unión a VAP-1 del mismo, caracterizado porque es completamente humano y comprende i) tres CDR de polipéptido de cadena pesada representados en los SEQ ID NOs: 4 , 9 y 14, respectivamente, y tres CDR de polipéptido de cadena ligera representados en los SEQ ID NO: 27, 32 y 37, respectivamente; en donde el anticuerpo anti-VAP-1 o un fragmento de unión a VAP-1 del mismo tiene una KD inferior a la de un anticuerpo anti-VAP-1 quimérico denominado BTT-1002, habiéndose estimado KD con un ensayo de resonancia de plasmón superficial de Biacore.

PDF original: ES-2690307_T3.pdf

Anticuerpos biespecíficos anti-VEGF/anti-ANG-2 y su uso en el tratamiento de enfermedades vasculares oculares.

(20/11/2018) Un procedimiento para la reducción de la viscosidad de un anticuerpo en el que el anticuerpo comprende una región de cadena pesada constante de la subclase IgG1 humana, en el que el procedimiento comprende la modificación de la región de la cadena pesada constante del anticuerpo de la subclase IgG1 humana con las mutaciones I253A, H310A y H435A (numeración de acuerdo con el índice UE de Kabat); y en el que el anticuerpo es un anticuerpo biespecífico que comprende un primer sitio de unión a antígeno que se une específicamente a VEGF humano y un segundo sitio de unión a antígeno que se une específicamente a ANG-2 humana, y en el…

Receptor de antígeno quimérico anti-toso y su uso.

(20/11/2018). Solicitante/s: UNIVERSITÄT ZU KÖLN. Inventor/es: HOMBACH,ANDREAS, FAITSCHUK,ELENA, ABKEN,HINRICH.

Célula T con un receptor de antígeno quimérico para su uso en terapia celular adoptiva para tratar cáncer TOSO+ en un sujeto que lo necesita, en la que el receptor de antígeno quimérico contiene al menos los siguientes dominios del extremo N-terminal al extremo C-terminal: i) un dominio de anticuerpo de cadena sencilla anti-TOSO, en particular, scFv de 6B10 de SEQ. ID. No. 2 o un homólogo del mismo que se une específicamente a TOSO que tiene una identidad de al menos el 70% con SEQ. ID. No. 2; ii) opcionalmente un dominio espaciador; iii) un dominio transmembrana; y iv) un dominio de señalización citoplásmico; caracterizada porque dicha célula T con el receptor de antígeno quimérico inicia o aumenta la respuesta inmunitaria a o es tóxica para células cancerosas TOSO+ en dicho sujeto.

PDF original: ES-2690420_T3.pdf

Antagonistas anti-beta7 humanizados y utilizaciones para los mismos.

(19/11/2018). Solicitante/s: GENENTECH, INC.. Inventor/es: FONG, SHERMAN, DENNIS, MARK, S..

Anticuerpo anti-beta7 que comprende una secuencia de armazón de cadena pesada de región variable que comprende las secuencias de aminoácidos expuestas como SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 45 y SEQ ID NO: 41, y una secuencia de armazón de cadena ligera de región variable que comprende los residuos de aminoácidos 1-23, 24-37, 38-69 y 70 hasta el último residuo de la secuencia de aminoácidos expuesta como SEQ ID NO: 15, y una HVR-L1, HVR-L2, HVR-L3, HVR-H1, HVR-H2 y HVR-H3, en las que cada una, en orden, comprende RASESVDDLLH (SEQ ID NO: 9), KYASQSIS (SEQ ID NO: 2), QQGNSLPNT (SEQ ID NO: 3), GFFITNNYWG (SEQ ID NO: 4), GYISYSGSTSYNPSLKS (SEQ ID NO: 5) y RTGSSGYFDF (SEQ ID NO: 66).

PDF original: ES-2690079_T3.pdf

Modulocinas basadas en el dominio sushi de IL-15 e IL-15r-alfa.

(19/11/2018) Inmunocitocina que comprende: a) un conjugado, y b) un anticuerpo inmunomodulador, o un fragmento del mismo que puede reaccionar con el mismo antígeno que su homólogo de anticuerpo, unido directa o indirectamente mediante covalencia a dicho conjugado, en el que dicho anticuerpo inmunomodulador o fragmento del mismo a. inhibe un receptor inmunosupresor y se selecciona del grupo que comprende antagonistas de CTL-A4, antagonistas de KIR inhibidores, antagonistas de BTLA, antagonistas de LAG3, antagonistas de HAVCR2, antagonistas de ADORA2A y antagonistas de PD-1, o b. estimula un receptor coestimulador y se selecciona del grupo que comprende agonistas de CD40, agonistas de CD137, agonistas de CD134 y agonistas…

Un método de purificación de anticuerpos.

(19/11/2018) Un método para la preparación de una población de anticuerpos en el que más del 65 % de la población son anticuerpos activos, que comprende: (a) cargar una muestra que comprende una mezcla de anticuerpos en una columna de intercambio catiónico preequilibrada, después, lavar opcionalmente la columna con un tampón de lavado y eluir los anticuerpos unidos a la columna con un tampón de elución, retirando de este modo las proteínas de la célula hospedadora (PCH) y las isoformas de anticuerpos de la muestra, en el que la muestra de la etapa (a) tiene una conductividad de 5 a 7 mS/cm; (b) cargar una muestra preparada mediante la mezcla de sal con el eluato de la etapa (a) en una columna de interacción hidrófoba (CIH) y eluir…

Anticuerpos anti-CD38 conjugados.

(19/11/2018). Solicitante/s: TAKEDA PHARMACEUTICAL COMPANY LIMITED. Inventor/es: BHASKAR,VINAY, HAAK-FRENDSCHO,MARY, LANDES,GREGORY, ELIAS,KATHLEEN ANN, SINGH,SHWETA, KORVER,WOUTER, DRAKE,ANDREW WALLING, SNELL,GYORGY PAL.

Un anticuerpo aislado que se une específicamente a CD38 humana (SEQ ID NO: 1) y a CD38 de cynomolgus (SEQ ID NO: 2) que comprende: a) una región variable de cadena pesada que comprende la SEQ ID NO: 9; y b) una región variable de cadena ligera que comprende la SEQ ID NO: 10.

PDF original: ES-2690095_T3.pdf

Anticuerpo capaz de reconocer específicamente un receptor de transferrina.

(15/11/2018) Anticuerpo que reacciona específicamente con TfR humano, que se selecciona de los siguientes , , , y : Un anticuerpo, en el que la primera región determinante de complementariedad de cadena pesada (CDR1 de VH), la segunda región determinante de complementariedad de cadena pesada (CDR2 de VH) y la tercera región determinante de complementariedad de cadena pesada (CDR3 de VH) corresponden a SEQ ID NO: 1, 2 y 7, respectivamente, y la primera región determinante de complementariedad de cadena ligera (CDR1 de VL), la segunda región determinante de complementariedad de cadena ligera (CDR2 de VL) y la tercera región determinante de complementariedad…

1 · · 3 · 5 · 9 · 18 · ››