394 patentes, modelos y diseños de THE REGENTS OF THE UNIVERSITY OF CALIFORNIA

Método y aparato para la detección de dianas usando virus unidos a electrodos.

Secciones de la CIP Física Química y metalurgia

(28/11/2018). Inventor/es: WEISS,GREGORY A, PENNER,REGINALD M, TAM,PHILLIP Y, YANG,LI-MEI, BRIGHAM,TYLER. Clasificación: G01N33/569, C12M1/34, C12Q1/70, G01N33/554.

Ensamblaje de biosensor que comprende: un electrodo de oro electroconductor operativamente acoplado a un analizador de impendancia para medir el cambio en la impendancia resistiva ΔZRe del electrodo; una monocapa autoensamblada químicamente unida a una superficie del electrodo de oro electroconductor a través de un enlace tiol-oro; y una pluralidad de partículas víricas de fago unidas de manera covalente a la monocapa autoensamblada.

PDF original: ES-2691647_T3.pdf

La terapia anti-EMP2 reduce las células madre cancerosas.

(13/11/2018) Un anticuerpo para uso en la reducción de células madre cancerosas que expresan EMP2 en un paciente que tiene cáncer y que se ha identificado previamente que comprende células madre cancerosas que expresan EMP2 y uno o más marcadores seleccionados del grupo que consiste en CD44, CD 133 ABCG2 y ALDH, en donde: a) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos: MAQVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAVYYCARDRRGRKSAGIDYWGQGTLVTVSS, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula** b) el anticuerpo comprende una cadena…

Modulador del receptor de andrógenos para el tratamiento del cáncer de próstata y enfermedades asociadas con el receptor de andrógenos.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(13/11/2018). Inventor/es: OUK, SAMEDY, JUNG, MICHAEL E., SAWYERS,Charles L, TRAN,Chris, WONGVIPAT,John. Clasificación: A61K31/4439, A61K31/4178, A61K31/4166, C07D401/04, C07D233/86.

Una composición farmacéutica que comprende un portador, diluyente o adyuvante farmacéuticamente aceptable y un compuesto que tiene la fórmula:**Fórmula** o una sal farmacéuticamente aceptable del mismo, estando formulada dicha composición en una forma de dosificación dividida, en donde la administración de dos o más formas de dosificación divididas a lo largo de un día proporciona una cantidad terapéuticamente eficaz del compuesto a un sujeto que lo necesite.

PDF original: ES-2689292_T3.pdf

Conjugados de LLP2A-bisfosfonato para el tratamiento de la osteoporosis.

(07/11/2018) Un compuesto de fórmula I:**Fórmula** en la que cada R1 y R2 se selecciona independientemente del grupo que consiste en H, halógeno, alquilo C1-6, alcoxi C1- 6 y haloalquilo C1-6; R3 se selecciona del grupo que consiste en H, alquilo C1-6 y cicloalquilo C3-8; X se selecciona del grupo que consiste en O, S y NH; Y se selecciona del grupo que consiste en O y NH; alternativamente, R1 o R2 se combina con Y y los átomos a los que están unidos forman un anillo heteroarilo de 5 miembros; Z es un péptido que tiene 3-20 aminoácidos seleccionados independientemente, en el que al menos un aminoácido se selecciona del grupo que consiste en un aminoácido no natural y un D-aminoácido;~ …

Fosfonato diésteres de nucleósido acíclico.

(30/10/2018) Un compuesto de Fórmula (Ia), o una sal farmacéuticamente aceptable del mismo: **Fórmula** en la que: BNuc(a) es: **Fórmula** La es un heteroalquilo C13-29 sin sustituir; Ra se selecciona entre el grupo que consiste en un alquilo C1-6 sin sustituir, un arilo sustituido o sin sustituir, un heteroarilo sustituido o sin sustituir, un heterocicloalquilo sustituido o sin sustituir, un aril(alquilo C1-6) sustituido o sin sustituir, un heteroaril(alquilo C1-6) sustituido o sin sustituir y un heterocicloalquil(alquilo C1-6) sustituido o sin sustituir; Xa es hidrógeno, un alquilo C1-6 no sustituido, un alquilo C1-6 sustituido con halógeno, un alquilo C1-6 sustituido con hidroxi o un alcoxi C1-6 sin sustituir; en el que el alquilo puede estar totalmente…

Generación de gotitas a demanda a alta velocidad y encapsulación de células individuales dirigida por una cavitación inducida.

(26/10/2018) Un método para la generación de gotitas en un dispositivo que comprende: proporcionar una primera trayectoria de fluido que comprende un primer fluido ; una segunda trayectoria de fluido que comprende un segundo fluido ; y una tercera trayectoria de fluido que comprende un tercer fluido ; y generar una burbuja de cavitación en la primera trayectoria de fluido , en el que la burbuja de cavitación imparte la suficiente velocidad a una porción del segundo fluido para extruir una gotita que comprende un volumen controlado del segundo fluido en la tercera trayectoria de fluido ; caracterizado por que hay una membrana flexible interpuesta entre la primera trayectoria de fluido y la segunda trayectoria de…

Expresión de CD127 que correlaciona inversamente con FoxP3 y la función supresora de Treg CD4+.

Secciones de la CIP Necesidades corrientes de la vida Física Química y metalurgia

(18/10/2018). Inventor/es: BLUESTONE,JEFFREY,A, LIU,WEIHONG, PUTNAM,AMY. Clasificación: A61K39/00, G01N33/569, G01N33/50, A61K35/12, C12N5/0783, A61K35/17.

Un método para preparar una población de células T aisladas reguladoras inmunosupresoras, comprendiendo dicho método: seleccionar una muestra que comprende células T por los niveles de expresión de un conjunto de marcadores que consiste en CD4, CD127 y CD25 para detectar células T CD4+CD127lo/-CD25+; y aislar las células T CD4+CD127lo/-CD25+ detectadas para proporcionar la población de células T aisladas reguladoras inmunosupresoras, en el que la población comprende al menos 103 células T reguladoras inmunosupresoras.

PDF original: ES-2686593_T3.pdf

Mitigación de la vecería con 9-beta-D-adenosina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(17/10/2018). Inventor/es: LOVATT, CAROL, J. Clasificación: A01N43/90, A01N43/08, C05B21/00, A01N57/16, A01P21/00.

Método de mitigación de la vecería en una planta de cultivo permanente, que comprende administrar a la planta de cultivo permanente una composición que comprende una cantidad eficaz de un compuesto natural purificado para mitigar la vecería en la planta de cultivo permanente, en el que el compuesto es 9- beta-D-adenosina.

PDF original: ES-2686282_T3.pdf

Nanopartículas magnéticas funcionalizadas y métodos de uso de las mismas.

Sección de la CIP Necesidades corrientes de la vida

(09/10/2018). Inventor/es: AKHTARI,MASSOUD, ENGEL,JEROME. Clasificación: A61P35/00, A61K49/18, A61P25/08, A61K47/69, A61K47/54.

Una composición farmacéutica que comprende: a) una nanopartícula magnética funcionalizada (MNP) que comprende al menos un resto funcional, en la que al menos un resto funcional comprende 2-desoxiglucosa (2DG), y en donde la MNP funcionalizada presenta afinidad diferencial y/o captación metabólica en un tejido epiléptico, en donde la nanopartícula magnética comprende una partícula de núcleo magnético y un sustrato biocompatible, y en la que la 2DG está unida al sustrato biocompatible, en la que la 2DG está unida al sustrato biocompatible a través de un oxígeno del grupo hidroxilo de la 2DG y en la que la 2DG está unida al sustrato biocompatible a través de los oxígenos de 6-OH, 1-OH, 3-OH o 4-OH de la 2DG; y b) un vehículo farmacéuticamente aceptable.

PDF original: ES-2685464_T3.pdf

Nanopartículas encapsuladas en membrana y método de utilización.

Sección de la CIP Necesidades corrientes de la vida

(08/10/2018). Inventor/es: ZHANG,LIANGFANG, FANG,RONNIE HONGBO, HU,CHE-MING, COPP,JONATHAN. Clasificación: A61K9/51.

Nanopartícula que comprende: a) un núcleo interno que comprende un material no celular; y b) una superficie externa que comprende una membrana plasmática derivada de una célula humana o animal, en la que dicho núcleo interno soporta la superficie externa y comprende un material biocompatible o sintético seleccionado de entre el grupo que consiste en poli(ácido láctico-co-glicólico) (PLGA), ácido poliláctico (PLA), ácido poliglicólico (PGA), policaprolactona (PCL), polilisina y ácido poliglutámico.

PDF original: ES-2685333_T3.pdf

Elemento de control de campo eléctrico para fonones.

(04/10/2018) Un transistor fonónico que comprende: contactos eléctricos (216A, 216B ; 312, 314; 308); dos puntos cuánticos (210A, 210B; 302A, 302B) incrustados en un semiconductor de modo que cuando se aplica un desvío eléctrico a los contactos eléctricos, un campo eléctrico que se produce por el desvío eléctrico es sustancialmente paralelo a un eje a través de los dos puntos cuánticos, en donde los dos puntos cuánticos incluyen un primero y un segundo punto cuántico, en donde el primer punto cuántico y el semiconductor proporcionan un estado continuo, en donde el segundo punto cuántico proporciona un estado discreto, en donde el estado continuo y el estado discreto se acoplan cuando el desvío eléctrico se aplica a los contactos eléctricos, y en donde el desvío eléctrico proporciona un mecanismo…

Plataforma de tecnología de control de sistema de retroalimentación en tiempo real con estimulaciones que cambian dinámicamente.

(03/10/2018) Un método, que comprende: (a) realizar mediciones de una variación del curso temporal de una dosificación de al menos un fármaco en un sistema biológico al que se ha aplicado el fármaco; (b) realizar mediciones de una variación del curso temporal de un resultado terapéutico del sistema biológico en respuesta al fármaco; (c) ajustar los resultados de las mediciones de la dosificación y el resultado terapéutico en un modelo del resultado terapéutico; y (d) usando el modelo del resultado terapéutico, identificar una dosis optimizada del fármaco, en el que: el al menos un fármaco es una combinación de N fármacos, siendo N 2 o más; la realización en (a) incluye realizar mediciones de una variación del curso temporal de dosificaciones…

Oligosacáridos de leche bovina.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(11/09/2018). Inventor/es: MILLS, DAVID, GERMAN,J. BRUCE, LEBRILLA,CARLITO B, BARILE,DANIELA, LOCASCIO,RICCARDO. Clasificación: C08B37/00, C07H1/08, A61K31/715, C13K5/00, A23C7/00, A61K35/745, A61K35/741.

Una composición que comprende un oligosacárido purificado de leche o producto de leche bovina, de cabra, oveja, búfalo, u otro mamífero no humano domesticado, en la que el oligosacárido está seleccionado del grupo que consiste en: un oligosacárido que consiste en 3 restos de Hex, 4 restos de HexNAc y 1 resto de fucosa (Fuc); un oligosacárido que consiste en 4 restos de Hex, 4 restos de HexNAc y 1 resto de Fuc; un oligosacárido que consiste en 5 restos de Hex, 4 restos de HexNAc y 1 resto de Fuc; un oligosacárido que consiste en 4 restos de Hex, 5 restos de HexNAc y 1 resto de Fuc; y un oligosacárido que consiste en 3 restos de Hex, 6 restos de HexNAc y 1 resto de Fuc.

PDF original: ES-2680920_T3.pdf

Métodos y composiciones para la producción acelerada de células epiteliales pigmentadas retinianas a partir de células pluripotentes.

Sección de la CIP Química y metalurgia

(05/09/2018). Inventor/es: COFFEY,PETER, CLEGG,DENNIS, BUCHHOLZ,DAVID, CROZE,ROXANNE, PENNINGTON,BRITNEY, LEACH,LYNDSAY. Clasificación: C12N5/02, C12N5/0793, C12N5/079.

Un método para la diferenciación de células madre pluripotentes de mamífero a células de epitelio pigmentado retiniano, el cual comprende: el cultivo de células madre pluripotentes en un primer medio que comprende un medio basal suplementado con IGF1, DKK1 y nogina; posteriormente, el cultivo de las células en un segundo medio que comprende un medio basal suplementado con IGF1, DKK1, nogina y BFGF; posteriormente, el cultivo de las células en un tercer medio que comprende un medio basal suplementado con IGF1, DKK1 y Activina A; y posteriormente, el cultivo de las células en un cuarto medio que comprende un medio basal suplementado con Activina A y SU5402, obteniéndose así células de epitelio pigmentado retiniano.

PDF original: ES-2688019_T3.pdf

Expansión de linfocitos T reguladores reactivos a aloantígeno.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(09/05/2018). Inventor/es: BLUESTONE,JEFFREY,A, TANG,QIZHI. Clasificación: A61K39/00, A61P37/00, A61K35/14, C12N5/0783, C12N5/0781, A61K35/17.

Un método para la producción de linfocitos T reguladores (Treg) reactivos de donador humanos, que comprende: a) cocultivar linfocitos B CD19+ de un donador hum 5 ano con células de alimentación de leucemia humana CD40L+ irradiadas en condiciones eficaces para producir linfocitos B estimulados (sBc); b) cocultivar linfocitos T CD4+, CD25+, CD127-/lo de un destinatario humano con dichos sBc en condiciones eficaces para expandir de forma selectiva los linfocitos T reguladores (Treg) reactivos de donador humanos; y c) restimular dichos Treg reactivos de donador por entrecruzamiento de CD3 y CD28 de dichos Treg reactivos de donador en condiciones eficaces para producir Treg reactivos de donador que son CD4+, Helios+ y Foxp3+; en el que el donador es de HLA no coincidente en relación con el destinatario humano.

PDF original: ES-2675317_T3.pdf

Métodos y composiciones para tratar y prevenir una enfermedad asociada con la integrina alfa V beta 5.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Física

(21/03/2018). Inventor/es: SHEPPARD, DEAN, ATAKILIT,AMHA. Clasificación: A61K39/00, C07K16/28, A61K39/395, G01N33/53, C12N5/20.

Un anticuerpo que se une específicamente a la subunidad ß5 de la integrina αvß5 para su uso en el tratamiento o prevención del edema pulmonar o en el tratamiento o prevención de la lesión pulmonar aguda, en el que dicho anticuerpo es un antagonista de la integrina αvß5.

PDF original: ES-2671522_T3.pdf

Polímeros para su uso en la separación centrífuga de líquidos.

(21/03/2018) Un procedimiento para separar una muestra de sangre completa en una fracción que contiene células y una fracción de suero, que comprende: obtener un tubo de recogida que comprende una composición polimerizable que incluye un fotoiniciador, en la que la composición polimerizable es fluida en la muestra de sangre completa y tiene una densidad entre 1,01- 1,09 g/cm3; esterilizar la composición polimerizable con radiación gamma sin curar la composición polimerizable más del 40 %; centrifugar el tubo de recogida que comprende la composición polimerizable con la muestra de sangre completa hasta que la sustancia separadora se deposite entre una fracción agotada en células y una fracción enriquecida en células; y posteriormente a la esterilización…

Nanopartículas magnéticas funcionalizadas y su uso en la formación de imágenes de depósitos amiloideos y ovillos neurofibrilares.

Sección de la CIP Necesidades corrientes de la vida

(14/03/2018). Inventor/es: AKHTARI,MASSOUD. Clasificación: A61B5/055, A61K49/18.

Una composición farmacéutica que comprende: a) una nanopartícula magnética funcionalizada (MNP) de fórmula M-(L)-Z or M-S-(L)-Z en la que M es un núcleo magnético, S es un polímero, L es un enlazador opcional y Z es un grupo funcional que une proteína ß-amiloidea agregada y/o ovillos neurofibrilares, en donde dicho grupo funcional está acoplado opcionalmente a través del enlazador, si está presente, al núcleo magnético o al polímero S, en donde dicha nanopartícula magnética funcionalizada es capaz, cuando se introduce en el torrente sanguíneo de un sujeto mamífero, de cruzar la barrera hematoencefálica de un sujeto mamífero, en donde el grupo funcional es 2-(1-{6-[(2- hidroxietil)(metil)amino]-2-naftil}etilideno)malononitrilo (HODDNP); y b) un vehículo farmacéuticamente aceptable.

PDF original: ES-2667894_T3.pdf

Método para el acondicionamiento y quimioselección combinadas en un único ciclo.

Sección de la CIP Necesidades corrientes de la vida

(07/03/2018). Inventor/es: KASAHARA,NORIYUKI, SCHIESTL,ROBERT H, HACKE,KATRIN, SZAKMARY,AKOS, CROOKS,GAY M. Clasificación: A61K35/14, A61P37/06, A61K35/28, A61K31/52.

Análogo de base purina para la utilización en un método de trasplante de células madre hematopoyéticas (HSC) sin radiación, en el que el análogo de base purina es la 6-tioguanina (6TG) y en el que el método comprende: (a) administrar en un sujeto mamífero una o dos dosis de entre 2 y 10 mg/kg de peso corporal del análogo de base purina a modo de etapa de preacondicionamiento, (b) injertar HSC del donante en el sujeto deficientes en hipoxantina-guanín fosforibosiltransferasa (HPRT) dentro de las 48 a 72 horas posteriores a la etapa de preacondicionamiento, y (c) administrar en el sujeto 1 a 5 mg/kg del análogo de base purina cada dos a cuatro días durante dos a ocho semanas después de la etapa de injertación, en el que el método se lleva a cabo en ausencia de preacondicionamiento mediante radiación.

PDF original: ES-2672693_T3.pdf

Composiciones y métodos para la separación de plasma rico en plaquetas.

(07/03/2018) Un método de separación de una fracción de PRP de una muestra de sangre total en un tubo de toma de muestras que incluye una sustancia separadora polimerizable, en el que la sustancia separadora polimerizable es autosuspensible con la sangre total, tiene un primer peso molecular medio, y tiene una densidad entre la densidad media de una fracción de PRP y la densidad media de una fracción no de PRP, en el que la sustancia separadora comprende un oligómero, un fotoiniciador y un estabilizante, comprendiendo el método: centrifugar la muestra de sangre total en el tubo de toma de muestras que incluye la sustancia separadora polimerizable durante un periodo entre uno y treinta minutos a entre 500 y…

Micropartículas porosas de silicio para la entrega de fármaco para el ojo.

Sección de la CIP Necesidades corrientes de la vida

(21/02/2018). Inventor/es: FREEMAN,WILLIAM, SAILOR,MICHAEL, CHENG,LINGYUN, CUNIN,FREDERIQUE, ANGLIN,EMILY, LI,YANG YANG. Clasificación: A61K47/26, A61K9/16, A61F9/00.

Un dispositivo para entrega de fármaco, para el uso en la entrega controlada de un fármaco o fármacos particular(es) a una ubicación particular del ojo, donde el dispositivo comprende: partículas porosas de silicio o dióxido de silicio con tamaño de micrones, que tienen poros configurados y dimensionados para recibir por lo menos parcialmente por lo menos un fármaco dentro de ellos; y en el que las partículas son adecuadas para ser entregadas dentro o sobre el ojo.

PDF original: ES-2669585_T3.pdf

Administración sistémica y expresión regulada de genes paracrinos para enfermedades cardiovasculares y otras afecciones.

Sección de la CIP Necesidades corrientes de la vida

(20/12/2017). Inventor/es: HAMMOND,H. KIRK, GAO,MEI HUA. Clasificación: A61K48/00, A61K9/06, A61P17/00, A61K38/17, A61P9/00, A61K9/08, A61K38/16.

Un vector que comprende una secuencia de ácidos nucleicos que codifica una proteína o un péptido paracrino para su uso en un método para tratar, mejorar o proteger a un sujeto que padece una insuficiencia cardiaca congestiva que comprende proporcionar y administrar o suministrar el vector a una célula del sujeto, o a un sujeto en necesidad del mismo en el que la proteína o el péptido paracrino comprende una proteína o un péptido de la Urocortina-2 (UCn-2), y el vector es un virus adenoasociado (AAV).

PDF original: ES-2660492_T3.pdf

Evaluación de la susceptibilidad a antibióticos utilizando sondas para arn prerribosómico.

(20/12/2017) Un método para determinar si una muestra de bacterias es susceptible a un agente antibiótico, comprendiendo el método los pasos de: (a) (a) poner en contacto un espécimen obtenido a partir de la muestra con una sonda o un par de sondas de oligonucleótidos en ausencia del agente, en donde la sonda o el par de sondas hibrida específicamente a una secuencia diana sobre la longitud completa de la secuencia diana, en donde la secuencia diana comprende 25-35 nucleótidos contiguos de ARN ribosómico (rARN) bacteriano que abarca un sitio de empalme entre una cola de ARN prerribosómico (prARN) y ARN ribosómico maduro (mrARN) (b) (b) poner en contacto un espécimen obtenido a partir de la muestra con la sonda o par de sondas en presencia del agente antibiótico; (c) (c) detectar las cantidades…

Conjugados de lípido-péptido-polímero y nanopartículas de los mismos.

Sección de la CIP Química y metalurgia

(22/11/2017). Inventor/es: XU,TING, DONG,HE, SHU,JESSICA. Clasificación: C07K14/47.

Un conjugado que comprende: un péptido helicoidal que tiene de 10 a 100 aminoácidos; un primer polímero unido covalentemente al péptido helicoidal en el que el primer polímero es un polímero hidrófilo seleccionado entre el grupo que consiste en polietilenglicol, poli(N-isopropilacrilamida) y celulosa y en el que el primer polímero se une al péptido helicoidal en un aminoácido distinto del N o C terminal; y un resto hidrófobo unido covalentemente al extremo N del péptido helicoidal, en el que el resto hidrófobo comprende un resto lipídico o un polímero hidrófobo seleccionado entre el grupo que consiste en polibutadieno, poliestireno, un poliacrilato, un polimetacrilato y polidiacetileno.

PDF original: ES-2659409_T3.pdf

Métodos y composiciones para la modificación de ADN objetivo dirigida por ARN y para la modulación de la transcripción dirigida por ARN.

(08/11/2017) Una composición que comprende: (a) una proteína Cas9 quimérica, o un polinucleótido que codifica dicha proteína Cas9 quimérica, en donde la proteína Cas9 quimérica comprende una proteína Cas9 modificada que tiene actividad nucleasa reducida en comparación con la Cas9 de tipo de silvestre correspondiente, y comprende un polipéptido heterólogo que: (i) tiene actividad modificadora de ADN, o (ii) muestra la capacidad de aumentar o reducir la transcripción, o (iii) tiene actividad enzimática que modifica un polipéptido asociado a ADN; y (b) un ARN dirigido a ADN, o uno o más polinucleótidos de ADN que codifican dicho ARN dirigido a ADN, en donde dicho ARN dirigido a ADN comprende: (i) un segmento de dirección a ADN que comprende…

Ensayo de pronóstico multigénico para el cáncer de pulmón.

Sección de la CIP Química y metalurgia

(08/11/2017). Inventor/es: MANN, MICHAEL, J., JABLONS,DAVID M, KRATZ,JOHANNES, BERRYMAN,DAVID. Clasificación: C12Q1/68.

Un método para proporcionar un pronóstico para el cáncer de pulmón no microcítico (CPNM) en un sujeto, comprendiendo el método las etapas de: (a) poner en contacto una muestra biológica del sujeto con reactivos que se unen de forma específica a cada miembro de un panel de biomarcadores que consiste en BAG1, BRCA1, CDC6, CDK2AP1, ERBB3, FUT3, IL11, LCK, RND3, SH3BGR y WNT3A; y (b) determinar una puntuación de riesgo del sujeto basada en los niveles de ácido nucleico de expresión de los biomarcadores en la muestra o determinar si los biomarcadores se expresan de forma diferencial o no a nivel de ácido nucleico en la muestra; y (c) proporcionar un pronóstico para el CPNM basado en la puntuación de riesgo del sujeto o en la expresión diferencial.

PDF original: ES-2658921_T3.pdf

Conjugados polipéptido-polímero y procedimientos de uso de los mismos.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(25/10/2017). Inventor/es: HEALY,KEVIN,E, WALL,SAMUEL T, SAHA,KRISHANU, SCHAFFER,DAVID. Clasificación: C07K19/00, C07K14/47, A61L27/54, A61L31/16, A61L31/04, A61L27/22.

Un conjugado de la formula: X-(Y)n-Z, en la que X es un polipeptido biologicamente activo que tiene un peso molecular de 2 kDa a 2000 kDa y en la que X es: i) un receptor; o ii) un ligando para un receptor, en donde el ligando activa una ruta de senalizacion en una celula eucariota; Y es un resto enlazador opcional, en donde n es 0 o un numero entero de 1 a 10; y Z es un polimero biocompatible que comprende de 50 a 100.000 subunidades, en el que la relacion molar entre el polipeptido biologicamente activo y el polimero es de 10:1 a 50:1; y en donde la CE50 del polipeptido en el conjugado es al menos 2 veces menor que la CE50 del polipeptido en forma soluble.

PDF original: ES-2656350_T3.pdf

Variaciones de composición del tetraboruro de wolframio con metales de transición y elementos ligeros.

Sección de la CIP Química y metalurgia

(18/10/2017). Inventor/es: KANER,RICHARD,B, TOLBERT,SARAH H, MOHAMMADI,REZA, LECH,ANDREW T, XIE,MIAO. Clasificación: C22C29/14, C22C29/18, C22C27/04, C22C25/00.

Una variación de la composición del tetraboruro de wolframio que comprende: wolframio (W); boro (B) y al menos un elemento seleccionado del grupo de elementos que consiste en: titanio (Ti), vanadio (V), cromo (Cr), manganeso (Mn), hierro (Fe), cobalto (Co), níquel (Ni), cobre (Cu ), zinc (Zn), circonio (Zr), niobio (Nb), molibdeno (Mo), rutenio (Ru), hafnio (Hf), tántalo (Ta), osmio (Os), iridio (Ir), litio (Li) ) y aluminio (Al), en la que dicha composición satisface la fórmula: W1-xMxXy en la que X es B, en la que M es al menos uno de: Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Zr, Nb, Mo, Ru, Hf, Ta, Os, Ir, Li y Al, en la que x es al menos 0,001 y es menor que 0,6 y en la que y es 4,0.

PDF original: ES-2655245_T3.pdf

Complejos luminiscentes de lantánidos macrocíclicos.

Secciones de la CIP Física Química y metalurgia

(04/10/2017). Inventor/es: RAYMOND, KENNETH, XU, JIDE, CORNEILLIE,TODD. Clasificación: G01N33/58, C07D245/04.

Un compuesto que tiene una estructura de acuerdo con la Fórmula III:**Fórmula** en donde L1, L2, L3, L4, L5, L6, L7, L8, L9 y L10 son miembros seleccionados independientemente de etileno sustituido o no sustituido; R1, R2, 10 R3 y R4 son miembros seleccionados independientemente de H, un grupo enzimáticamente lábil, un grupo hidrolíticamente lábil, un grupo metabólicamente lábil y una carga negativa única; R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15 y R16 son H; L11 es heteroalquileno sustituido o no sustituido o alquileno sustituido o no sustituido; y X es un miembro seleccionado de una amina, un ácido carboxílico, un maleimidilo, un tiazolidilo, un éster de NHS sustituido o no sustituido, un éster de NHS sulfonado y una porción succinimidilo.

PDF original: ES-2655082_T3.pdf

Receptor de antígeno quimérico y métodos de uso del mismo.

(04/10/2017) Un receptor de antígeno quimérico (CAR) heterodimérico condicionalmente activo que comprende: a) un primer polipéptido que comprende: i) un primer miembro de un par de unión específica; ii) un primer dominio coestimulador; iii) un primer miembro de un par de dimerización; y iv) un dominio transmembrana interpuesto entre el primer miembro de un par de unión específica y el primer dominio coestimulador; y b) un segundo polipéptido que comprende: i) un dominio transmembrana; ii) un segundo dominio coestimulador; iii) un segundo miembro del par de dimerización; y iv) un dominio de señalización intracelular; o que comprende: a) un primer polipéptido que comprende: i) un primer miembro de un par de unión específica; ii) un dominio coestimulador; iii) un primer miembro de un par de…

Métodos y composiciones de tratamiento de heridas y reducción del riesgo de hernias incisionales.

Sección de la CIP Necesidades corrientes de la vida

(13/09/2017). Inventor/es: HARRIS,HOBART W. Clasificación: A61K38/48, A61K38/00, A61P17/02, A61K38/36, A61K33/38.

Una composición farmacéutica para su uso en un método de tratamiento de un sitio de una incisión abdominal en un sujeto, comprendiendo la composición farmacéutica un primer agente de material precursor que comprende fibrinógeno, un segundo agente de material precursor, que comprende trombina, y partículas de plata.

PDF original: ES-2645082_T3.pdf

Anticuerpos de NKG2D para su uso en el tratamiento de artritis reumatoide o enfermedad de Crohn.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(30/08/2017). Inventor/es: LANIER, LEWIS, L., OGASAWARA,KOETSU, BLUESTONE,JEFFREY,A. Clasificación: C07K16/28, A61K39/395, A61P1/00, A61P37/02, A61K38/00, A61P19/02.

Un agente que es específico para NKG2D y es capaz de alterar la expansión de células T NKG2D+ o células NK sin empobrecer dichas células, para su uso en el tratamiento de artritis reumatoide o enfermedad de Crohn, en donde el agente es un anticuerpo o un fragmente de anticuerpo.

PDF original: ES-2645026_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · 9 · 10 · 11 · 12 · ››