11 inventos, patentes y modelos de BOYLE, WILLIAM, J.

Anticuerpos para OPGL.

(30/05/2018) Una composición que comprende un primer polinucleótido y un segundo polinucleótido, en la que el primer polinucleótido codifica una cadena pesada y el segundo polinucleótido codifica una cadena ligera, en la que: a) la cadena pesada se selecciona de una cadena pesada de longitud completa y fragmentos de polipéptido de la misma que tiene suficiente secuencia de regiones variables para conferir especificidad para un OPGL, y la cadena pesada comprende una primera región variable que comprende una secuencia que tiene por lo menos 90% de identidad a la secuencia establecida en la SEQ ID NO:13, y b) la cadena ligera se selecciona de una cadena ligera de longitud…

Anticuerpo monoclonal para la proteina de union a osteoprotegerina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(07/12/2016). Solicitante/s: AMGEN INC.. Clasificación: A61P35/00, C12N15/13, C12N5/10, C07K14/705, C07K16/28, C12N15/09, A61K45/00, A61K39/395, A61P43/00, C12P21/08, A61K45/06, A61P29/00, C12N1/19, A61K38/22, A61P19/00, C12N1/21, A61P19/02, C07K14/52, A61P35/04, A61P19/10, A61P3/14, C12N1/15.

Un anticuerpo monoclonal o un dominio de unión a antígeno del mismo que se une a una porción de la secuencia de aminoácidos: GGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP (SEQ ID NO: 76) desde el resto de aminoácido 212 hasta el resto de aminoácido 250 de OPGbp (proteína de unión a osteoprotegerina) humana, en donde el anticuerpo o el dominio de unión a antígeno del mismo inhibe la formación o la activación de osteoclastos mediada por OPGbp humana.

PDF original: ES-2612124_T3.pdf

Agentes de union selectivos a antígenos de la proteína de unión a osteoprotegerina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(14/09/2016). Solicitante/s: AMGEN INC.. Clasificación: A61P35/00, C12N15/13, C12N15/85, C12N5/10, C07K14/705, C07K16/28, C12N15/09, A61K45/00, A61K39/395, A61P43/00, C12P21/08, C07K16/46, A61P29/00, C12N1/19, A61K38/22, A61P19/00, C12N1/21, A61P19/02, A61P35/04, A61P19/10, A61P3/14, C12N1/15.

Un anticuerpo o dominio de unión a antígeno que reconoce un epítopo DE en proteína de unión a osteoprotegerina humana (OPGbp), a) siendo el epítopo DE un epítopo que comprende una porción de la secuencia de aminoácido de la región DE de OPGbp humana desde el radical de aminoácido 212 hasta el radical de aminoácido 250 de la secuencia GFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP, y b) comprendiendo el epítopo DE la secuencia DLATE.

PDF original: ES-2307594_T5.pdf

PDF original: ES-2307594_T3.pdf

Proteínas de unión a osteoprotegerina y sus receptores.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Física

(06/01/2016). Solicitante/s: AMGEN INC.. Clasificación: A61K39/00, A61K48/00, C12N15/12, C12N5/10, C07K14/705, C07K16/28, C12N15/09, A61K39/395, A61K31/70, G01N33/53, G01N33/68, C12N15/11, G01N33/50, G01N33/577, C12P21/08, G01N33/566, A61K38/17, A61P19/08, C12N1/19, A61K38/00, A61P19/00, C12N1/21, A61K31/7088, A61P19/02, A61P19/10, A61P3/14, C12N1/15.

La invención se refiere a un nuevo polipéptido, proteína de unión de osteoprotegerina, que interviene en la maduración de osteoclastos y que se ha identificado debido a su afinidad por la osteoprotegerina. Se describen también las secuencias de ácidos nucleicos que codifican el polipéptido, o fragmentos, o derivados o análogos de estos, vectores y células huésped para la producción, procedimientos de preparación de la proteína de unión de osteoprotegerina, y ensayos de fijación. La invención se refiere también a composiciones y procedimientos para el tratamiento de enfermedades óseas tales como osteoporosis, pérdida de hueso debida a artritis o metástasis, hipercalcemia, y enfermedad de Paget. Se describen también los receptores para las proteínas de unión de la osteoprotegerina. Se pueden emplear los receptores, y agonistas y antagonistas de estos para tratar enfermedades óseas.

PDF original: ES-2284203_T3.pdf

PDF original: ES-2284203_T5.pdf

Agentes de unión selectivos antagonistas de proteína de unión de osteoprotegerina.

(10/09/2014) Un anticuerpo o dominio de unión a antígeno del mismo que se une a la proteína de unión osteoprotegerina (OPGbp) humana y a la OPGbp murina que comprende las sustituciones de aminoácidos S229D, V230L, P231A, y D233E, pero que no se une a la OPGbp murina que carece de dichas sustituciones.

ANTICUERPOS DEL OPGL.

(15/07/2010) Un anticuerpo, que comprende una cadena pesada y una cadena ligera, donde: a) la cadena pesada comprende: 1) una secuencia de aminoácidos recogida en SEQ ID NO: 2; o 2) una secuencia de aminoácidos recogida en SEQ ID NO: 13; y b) la cadena ligera comprende: 1) una secuencia de aminoácidos recogida en SEQ ID NO: 4; o 2) una secuencia de aminoácidos recogida en SEQ ID NO: 14; y donde el anticuerpo se une a un ligando de osteoprotegerina (OPGL) e inhibe la unión del OPGL a un receptor de diferenciación y activación de osteoclasto (ODAR)

OSTEOPROTEGERINA.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Física

(01/04/2009). Ver ilustración. Solicitante/s: AMGEN INC.. Clasificación: A61K48/00, C12N15/12, C12N15/62, C12N5/10, C07K16/28, C12Q1/68, C07K19/00, G01N33/50, G01N33/566, C07K14/715, A61K38/17, C07K1/107, A01K67/027, C12N1/21.

LA PRESENTE INVENCION DESCRIBE UN POLIPEPTIDO DE SECRECION, DENOMINADO OSTEOPROTEGERINA (OPG), QUE ES UN MIEMBRO DE LA SUPERFAMILIA DE RECEPTORES DEL FACTOR DE NECROSIS TUMORAL, Y ESTA IMPLICADO EN LA REGULACION DEL METABOLISMO OSEO. ASIMISMO, SE DESCRIBEN ACIDOS NUCLEICOS QUE CODIFICAN PARA OSTEOPROTEGERINA (OPG), POLIPEPTIDOS, VECTORES RECOMBINANTES Y CELULAS HUESPED PARA SU EXPRESION; ANTICUERPOS QUE SE UNEN A OPG, Y COMPOSICIONES FARMACEUTICAS QUE LA CONTIENEN. DICHOS POLIPEPTIDOS, SE UTILIZAN PARA TRATAR ENFERMEDADES OSEAS CARACTERIZADAS POR UNA RESORCION INCREMENTADA, COMO LA OSTEOPOROSIS.

AGENTES DE UNION SELECTIVOS A ANTIGENOS DE LA PROTEINA DE UNION A OSTEOPROTEGERINA.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(01/12/2008). Ver ilustración. Solicitante/s: AMGEN INC.. Clasificación: A61P35/00, C12N15/13, C12N15/85, C12N5/10, C07K16/28, A61K39/395, C07K16/46, A61K38/22, A61P19/10.

Un anticuerpo o dominio de unión a antígeno que reconoce un epítopo DE en proteína de unión a osteoprotegerina humana (OPGbp), a) siendo el epítopo DE un epítopo que comprende una porción de la secuencia de aminoácido de la región DE de OPGbp humana desde el radical de aminoácido 212 hasta el radical de aminoácido 250 de la secuencia GFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP, y b) comprendiendo el epítopo DE la secuencia DLATE.

PROTEINAS DE UNION A OSTEOPROTEGERINA Y RECEPTORES.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida Física

(01/11/2007). Ver ilustración. Solicitante/s: AMGEN INC.. Clasificación: C12N15/12, C12N5/10, C07K14/705, C07K16/28, A61K39/395, A61K31/70, G01N33/68, C12N15/11, G01N33/50, G01N33/577, A61K38/17, C12N1/21.

La invención se refiere a un nuevo polipéptido, proteína de unión de osteoprotegerina, que interviene en la maduración de osteoclastos y que se ha identificado debido a su afinidad por la osteoprotegerina. Se describen también las secuencias de ácidos nucleicos que codifican el polipéptido, o fragmentos, o derivados o análogos de estos, vectores y células huésped para la producción, procedimientos de preparación de la proteína de unión de osteoprotegerina, y ensayos de fijación. La invención se refiere también a composiciones y procedimientos para el tratamiento de enfermedades óseas tales como osteoporosis, pérdida de hueso debida a artritis o metástasis, hipercalcemia, y enfermedad de Paget. Se describen también los receptores para las proteínas de unión de la osteoprotegerina. Se pueden emplear los receptores, y agonistas y antagonistas de estos para tratar enfermedades óseas.

APARATO INTRODUCTOR PARA USO MEDICO.

Sección de la CIP Necesidades corrientes de la vida

(16/10/2005). Ver ilustración. Solicitante/s: COOK VASCULAR INCORPORATED. Clasificación: A61M25/00, A61M25/06.

Un aparato introductor para uso médico, que comprende una primera y una segunda fundas introductoras , cada una de las cuales tiene una parte distal , una parte proximal y un paso que se extiende longitudinalmente a su través, estando configuradas la primera y la segunda fundas introductoras para extenderse conjuntamente dentro de un paso del cuerpo, extendiéndose la parte distal de la segunda funda introductora, al menos parcialmente, más allá de la parte distal de la primera funda introductora, caracterizado porque la primera y la segunda fundas introductoras están configuradas de manera que puedan dividirse longitudinalmente, y porque la primer funda introductora incluye una curva preformada en una parte de dicha funda que se extiende en dicho paso del cuerpo.

LIGANDOS DEL RECEPTOR ECK.

Secciones de la CIP Química y metalurgia Física Necesidades corrientes de la vida

(16/12/1998). Solicitante/s: AMGEN INC.. Clasificación: C07K14/00, C12N15/12, G01N33/68, A61K38/00, G01N21/55.

SE PRESENTAN LIGANDOS QUE SE ENLAZAN AL RECEPTOR ECK. EN PARTICULAR, SE PRESENTAN POLIPEPTIDOS QUE SE ENLAZAN ESPECIFICAMENTE AL RECEPTOR ECK (PROTEINAS QUE SE ENLAZAN AL RECEPTOR ECK O EBPS) Y LAS SECUENCIAS DE ADN QUE CODIFICAN DICHOS POLIPEPTIDOS. SE PRESENTAN METODOS DE TRATAMIENTO EN LOS QUE SE UTILIZAN LOS LIGANDOS DEL RECEPTOR ECK Y UN RECEPTOR ECK SOLUBLE ASI COMO LAS COMPOSICIONES FARMACEUTICAS QUE LOS CONTIENEN. SE PRESENTA UN METODO RAPIDO Y SENSIBLE PARA LA DETECCION DE LA ACTIVIDAD DE ENLACE DEL RECEPTOR EN MUESTRAS EN CRUDO.

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015