7 inventos, patentes y modelos de BAKKER,ALEXANDER,BERTHOLD,HENDRIK

Anticuerpo que se une a CD3 humano.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(12/12/2018). Solicitante/s: Merus N.V. Clasificación: A61K39/00, C07K16/28, A61K39/395.

Un anticuerpo que se une a CD3 humano cuyo anticuerpo comprende una cadena pesada y una cadena ligera en donde dicha cadena pesada comprende una región variable que comprende la secuencia de aminoácidos:**Fórmula** con 0-5 sustituciones de aminoácidos en una o más posiciones distintas de la posición indicada por X1X2 y distintas de las regiones CDR; en donde X1 ≥ N y X2 ≥ A; X1 ≥ N y X2 ≥ T; X1 ≥ H y X2 ≥ G; X1 ≥ D y X2 ≥ G; o X1 ≥ H y X2 ≥ A; y dicha cadena ligera comprende la región variable de la cadena ligera O12/IgVκ 1-39 de la figura 23A con 0-5 sustituciones de aminoácidos.

PDF original: ES-2693596_T3.pdf

Anticuerpos IgG biespecíficos como acopladores de células T.

Sección de la CIP Química y metalurgia

(05/12/2018). Solicitante/s: Merus N.V. Clasificación: C07K16/28.

Un anticuerpo IgG biespecífico humano de longitud completa, en donde dicho anticuerpo IgG biespecífico comprende un brazo que reconoce específicamente CLEC12A y un segundo brazo que reconoce específicamente CD3, y en donde el brazo que reconoce específicamente CLEC12A comprende una secuencia variable de cadena pesada que consiste en una secuencia que es idéntica a QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGG STSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAKGTTGDWFDYWGQGT LVTVSS; o una secuencia variable de cadena pesada que consiste en una secuencia que es idéntica a **Fórmula** y en donde ambos brazos comprenden una cadena ligera común que comprende una secuencia variable de cadena ligera que consiste en una secuencia que es idéntica a **Fórmula**.

PDF original: ES-2692951_T3.pdf

Formulaciones líquidas de anticuerpo anti-rabia.

(24/08/2016) Una formulación farmacéutica de dos anticuerpos monoclonales anti-rabia que es estable durante al menos 12 meses a una temperatura entre 2 ºC y 8 ºC, que comprende: (i) anticuerpo monoclonal del virus anti-rabia CR57 (cadena pesada SEQ ID NO: 1 y cadena ligera SEQ ID NO: 2), o un anticuerpo que tiene una homología de secuencia de al menos un 95 % con el mismo y que es capaz de competir por una unión a la diana reconocida por CR57 y que tiene actividad de neutralización del virus de la rabia; y (ii) anticuerpo monoclonal del virus anti-rabia CR4098 (cadena pesada SEQ ID NO: 3 y cadena ligera SEQ ID NO: 4), o un anticuerpo que tiene una homología de secuencia de al menos un…

Moléculas de unión que pueden neutralizar el virus de la rabia y usos de las mismas.

(05/03/2014) Composición farmacéutica que comprende al menos dos moléculas de unión que neutralizan el virus de la rabia que pueden reaccionar con epítopos diferentes, no competitivos del virus de la rabia, en la que una primera molécula de unión que neutraliza el virus de la rabia puede reaccionar con un epítopo que comprende los aminoácidos 226-231 de la proteína G del virus de la rabia y una segunda molécula de unión que neutraliza el virus de la rabia puede reaccionar con un epítopo ubicado en el sitio antigénico III que comprende los aminoácidos 330-338 de la proteína G del virus de la rabia

Método para identificar moléculas de unión que pueden neutralizar el virus de la rabia.

(24/10/2013) Método para identificar una molécula de unión que potencialmente tiene actividad neutralizante contra elvirus de la rabia o una molécula de ácido nucleico que codifica una molécula de unión que potencialmentetiene actividad neutralizante contra el virus de la rabia, en donde el método comprende las etapas de: a) poner en contacto una colección de moléculas de unión en la superficie de paquetes genéticosreplicables con un virus de la rabia en condiciones que conducen a la unión, en donde la colecciónde moléculas de unión se prepara a partir de ARN aislado de células obtenidas de un sujetohumano que ha sido vacunado contra la rabia o que ha sido expuesto al virus de la rabia. b) separar y recuperar moléculas de unión que se unen al virus de la rabia de moléculas de uniónque no se unen, c) aislar al menos una molécula de unión recuperada, d)…

MOLÉCULAS DE UNIÓN QUE PUEDEN NEUTRALIZAR EL VIRUS DE LA RABIA Y USOS DE LAS MISMAS.

(11/07/2011) Molécula de unión que tiene actividad neutralizante contra el virus de la rabia, caracterizada por que la molécula de unión comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 39 y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 63, o una región variable de cadena pesada y ligera que tiene al menos un 80% de homología de secuencia con las mismas y en la que uno o más aminoácidos están alterados en comparación con la SEQ ID NO: 39 y la SEQ ID NO: 63 y que puede competir para unirse específicamente al virus de la rabia o a un fragmento del mismo con la molécula de unión que comprende…

AGONISTAS DEL RECEPTOR OX40=(=CD134) Y USO TERAPEUTICO.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Física

(16/04/2008). Ver ilustración. Solicitante/s: CRUCELL HOLLAND B.V.. Clasificación: A61P35/00, A61K31/00, C07K16/28, G01N33/68, A61K49/00, A61P31/00, A61P37/04, A61K51/10, G01N33/564.

Una molécula de unión agonista capaz de unirse a y estimular el receptor OX40 humano, caracterizado en que la molécula de unión es una molécula de unión humana que tiene un efecto estimulador sinergístico cuando se coincuba con el ligando OX40, en donde la molécula de unión comprende un región CDR3 de cadena pesada que comprende la secuencia de aminoácidos DRYSQVHYALDY (SEQ ID NO: 17) o la secuencia de aminoácidos YDNVMGLYWFDY (SEQ ID NO: 24).

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015