343 patentes, modelos y diseños de AMGEN INC.

Métodos para incrementar el contenido de manosa de proteínas recombinantes.

(28/11/2018) Un método para la modulación de una o más especies de glucano de alta manosa sobre una proteína recombinante durante el cultivo de célula mamífera que comprende: establecer un cultivo de célula mamífera en un biorreactor con un medio de cultivo definido libre de suero que contiene 5 a 8 g/l de glucosa; cultivar las células mamíferas durante una fase de crecimiento y complementar el medio de cultivo con alimentaciones por bolo de un medio de alimentación definido libre de suero de 5 a 8 g/l de glucosa; iniciar una fase de producción en el cultivo celular mediante perfusión con un medio de perfusión libre de suero que tiene 5 a 15 g/l de glucosa; y …

Anticuerpo monomérico Fc.

Sección de la CIP Química y metalurgia

(07/11/2018). Inventor/es: ZHOU,Hongxing, KANNAN,GUNASEKARAN, SUN,NANCY. Clasificación: C07H21/00, C07K16/28, C12P21/08, C07K16/00, C07K16/36.

Un polipéptido Fc monomérico que comprende un dominio CH2 y CH3, en el que dicho dominio CH3 es un dominio CH3 de IgG y comprende: (a) dos o más aminoácidos cargados que son electrostáticamente desfavorables para la formación de homodímeros de CH3, en el que los aminoácidos cargados son K392D y K409D; y (b) una sustitución de aminoácido de uno o más restos de la superficie de contacto hidrófoba con un resto de aminoácido polar, en el que la sustitución del resto de la superficie de contacto hidrófoba se selecciona del grupo que consiste en Y349T, L351T, L368T y F405T.

PDF original: ES-2688978_T3.pdf

Proteínas específicas para BAFF y B7RP1 y usos de las mismas.

(24/10/2018) Proteína biespecífica, que comprende: (a) un polipéptido que comprende una secuencia de aminoácidos que tiene la siguiente fórmula: A-L1-P-L2- P, en la que A es una cadena pesada de inmunoglobulina de un anticuerpo de IgG, L1 es un primer ligador peptídico que está ausente o tiene de 3 a 40 aminoácidos de longitud, P es un péptido de unión a BAFF que tiene de 10 a 40 aminoácidos de longitud, y L2 es un segundo ligador peptídico que está ausente o tiene de 5 a 50 aminoácidos de longitud, y en la que la cadena pesada de inmunoglobulina de (a) y la cadena ligera de inmunoglobulina de (b) forman un anticuerpo de IgG, que comprende dos moléculas del polipéptido de (a) y dos moléculas de la cadena ligera de (b), que puede unirse a…

Método para el tratamiento de la osteoporosis.

Sección de la CIP Necesidades corrientes de la vida

(09/10/2018). Inventor/es: SAN MARTIN,JAVIER, WASSERMAN,SCOTT. Clasificación: A61K39/395.

Un anticuerpo antiesclerostina que comprende una CDR-H1 de la SEQ ID NO: 245, una CDR-H2 de la SEQ ID NO: 246, una CDR-H3 de la SEQ ID NO: 247, una CDR-L1 de la SEQ ID NO: 78, una CDR-L2 de la SEQ ID NO: 79 y una CDR-L3 de la SEQ ID NO: 80, para uso en un método para aumentar la densidad mineral ósea en una mujer postmenopáusica, comprendiendo el método administrar, a una mujer postmenopáusica que tiene una puntuación T de las vértebras lumbares de menos de o igual a -2, dicho anticuerpo antiesclerostina en una cantidad y durante un periodo de tratamiento eficaces para aumentar la densidad mineral ósea (DMO) de las vértebras lumbares al menos un 9 % respecto al valor inicial previo al tratamiento a los doce meses después de la administración inicial del anticuerpo antiesclerostina; en el que la cantidad de anticuerpo antiesclerostina administrada es de 140 mg a 210 mg y la cantidad del anticuerpo antiesclerostina se administra a un intervalo con una frecuencia no superior a una vez al mes.

PDF original: ES-2685479_T3.pdf

Anticuerpos para OPGL.

(30/05/2018) Una composición que comprende un primer polinucleótido y un segundo polinucleótido, en la que el primer polinucleótido codifica una cadena pesada y el segundo polinucleótido codifica una cadena ligera, en la que: a) la cadena pesada se selecciona de una cadena pesada de longitud completa y fragmentos de polipéptido de la misma que tiene suficiente secuencia de regiones variables para conferir especificidad para un OPGL, y la cadena pesada comprende una primera región variable que comprende una secuencia que tiene por lo menos 90% de identidad a la secuencia establecida en la SEQ ID NO:13, y b) la cadena ligera se selecciona de una cadena ligera de longitud…

Inyector y método de ensamblaje.

(25/04/2018) Un inyector que comprende: un recipiente que incluye una pared con una superficie interior y un conjunto de sello con una superficie interior , la superficie interior de la pared y el conjunto de sello definiendo un depósito estéril cerrado , en el que la pared del recipiente define una perforación que incluye el depósito estéril ; un volumen de un producto de fármaco dispuesto en el depósito estéril , el producto fármaco comprendiendo un factor de estimulación de colonia de granulocito (G-CSF); un sistema de suministro de fluido que comprende una aguja de recipiente que tiene una punta , la punta solo dispuesta parcialmente a través del conjunto de sello en un estado de almacenamiento, y dispuesta a través del conjunto de sello…

Variantes de Fc.

(25/04/2018) Una proteína que contiene Fc que comprende una región Fc de IgG1 o IgG3 humana y una región de unión, en la que la región Fc comprende una cadena A y una cadena B, que cada una comprende de 1 a 10 sustituciones de aminoácidos relativas a una cadena polipeptídica de Fc humano tipo silvestres, seleccionadas de las siguientes, las cuales se numeran según el sistema de UE: E233L, L234I, L234Y, L235S, G236Y, S239D, S239E, S239N, S239T, F243M, F243L, F243V, F243I, K246W, K246E, K246S, K246V, K248Y, K248L, M252D, I253V, I253K, R255S, R255N, T256V, T256Q, E258S, E258V, H268E, H268K, A287F, K288T, K288I, K290G, K290F, K290S,…

Eliminación de ligando de purificación por afinidad filtrado.

Secciones de la CIP Química y metalurgia Técnicas industriales diversas y transportes

(25/04/2018). Inventor/es: TREJO,SAMUEL RAY, BRAKE,ROBERT PERRY. Clasificación: C07K14/705, C07K16/00, C07K14/715, C07K16/06, C07K1/22, C07K1/18, B01D15/36.

Un método para purificar una proteína de fusión recombinante del receptor del factor de necrosis tumoral Fc (TNFRFc), preferiblemente etanercept, a partir de una muestra que contiene la proteína recombinante y una segunda proteína que se une a la proteína, que comprende someter la muestra a un medio de cromatografía de matriz de intercambio aniónico tentacular en condiciones en las que la proteína recombinante se une al medio de cromatografía de matriz de intercambio aniónico tentacular, seguido por elución de la proteína recombinante unida al medio de cromatografía en un eluyente, recuperando al menos el 85% de la proteína recombinante en el eluyente y al menos el 75% de la segunda proteína se elimina del eluyente; en donde a) la segunda proteína es Proteína A o Proteína G; y b) el medio de cromatografía de matriz de intercambio aniónico tentacular contiene trimetilamonioetilo (TMAE).

PDF original: ES-2674697_T3.pdf

Anticuerpos para OPGL.

(28/03/2018) Un anticuerpo, que comprende una cadena pesada y una cadena ligera, a) en el que la cadena pesada se selecciona de una cadena pesada de longitud completa y fragmentos de polipéptido de la misma que tiene suficiente secuencia de regiones variables para conferir especificidad para un OPGL, y la cadena pesada comprende una primera región variable que comprende una secuencia de aminoácidos que tiene por lo menos 90% de identidad a la secuencia de aminoácidos establecida en la SEQ ID NO:13, y b) en el que la cadena ligera se selecciona de una cadena ligera de longitud completa y fragmentos de polipéptido de la misma que tiene suficiente secuencia de regiones variables para conferir especificidad para un OPGL, y la cadena ligera comprende una segunda región variable que comprende una secuencia de aminoácidos que tiene…

Método para el tratamiento de los defectos de espacio óseo.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(21/02/2018). Inventor/es: KE, HUA, ZHU, LI,XIAODONG. Clasificación: A61K39/00, A61P19/00, C07K16/22.

Una cantidad eficaz de un anticuerpo anti-esclerostina para su uso en un método para tratar un defecto de espacio óseo en un sujeto mamífero, en el que dicho anticuerpo es un inhibidor de esclerostina, comprendiendo dicho método administrar el anticuerpo al sujeto, en el que el anticuerpo anti-esclerostina es administrado durante un período de tratamiento que dura al menos 20 semanas, y en el que el defecto de espacio óseo comprende un espacio entre dos segmentos de hueso de al menos 5 mm.

PDF original: ES-2667554_T3.pdf

Métodos y composiciones para la prevención y tratamiento de la anemia.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(10/01/2018). Inventor/es: ELLIOTT, STEVEN, G., BROWN, JEFFREY, K., EGRIE,JOAN,C. Clasificación: A61K38/18, C12N15/12, C12N5/10, C12N15/09, A61K47/42, A61K47/10, C12N1/19, A61K38/22, A61K38/00, C07K14/505, A61P7/06, C12N1/15.

Utilización de un análogo hiperglicosilado de la eritropoyetina para la preparación de una composición farmacéutica para elevar y mantener el hematocrito en un mamífero, en donde el análogo es para ser administrado menos frecuentemente que una cantidad molar equivalente de la eritropoyetina humana recombinante, con el fin de obtener un hematocrito diana comparable, y en donde el análogo comprende, al menos, un sitio adicional de glicosilación, en comparación con la eritropoyetina humana, en cualquiera de las posiciones 30 y 88 de la secuencia de la eritropoyetina humana, de tal forma que el análogo comprende, al menos, una cadena adicional de carbohidratos ligada a N.

PDF original: ES-2283139_T3.pdf

PDF original: ES-2283139_T5.pdf

Anticuerpos dirigidos a angiopoyetina-1 y angiopoyetina-2 y uso de los mismos.

(03/01/2018) Anticuerpo monoclonal aislado que comprende un dominio variable de cadena pesada y un dominio variable de cadena ligera, en el que dicha cadena pesada comprende 3 CDR y dicha cadena ligera comprende 3 CDR, en el que las secuencias de dichas CDR de dicho anticuerpo se seleccionan del grupo que consiste en: (a) SEQ ID NO: 18, 26, 32 de la HC más SEQ ID NO: 19, 27, 33 de la LC, (b) SEQ ID NO: 18, 26, 34 de la HC más SEQ ID NO: 19, 27, 33 de la LC, (c) SEQ ID NO: 18, 26, 35 de la HC más SEQ ID NO: 20, 27, 36 de la LC, (d) SEQ ID NO: 18, 26, 37 de la HC más SEQ ID NO: 19, 27, 33 de la LC, (e) SEQ ID NO: 18, 26, 38 de la HC más SEQ ID NO: 19, 27, 33 de la LC, (f) SEQ ID NO: 18, 26, 35 de la HC más SEQ ID NO: 19, 27, 33 de la LC, (g) SEQ ID NO: 18, 26, 34…

Proteínas de unión al antígeno C-FMS humano.

(01/11/2017) Un anticuerpo seleccionado del grupo que consiste en un anticuerpo que comprende regiones determinantes de complementariedad (CDR) CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 y CDRL3, donde dichas CDR comprenden las secuencias de aminoácidos como se expone a continuación: (a) CDRH1 comprende SEQ ID NO: 147, CDRH2 comprende SEQ ID NO: 163, CDRH3 comprende SEQ ID NO: 186, CDRL1 comprende SEQ ID NO: 193, CDRL2 comprende SEQ ID NO: 214, y CDRL3 comprende SEQ ID NO: 228, (b) CDRH1 comprende SEQ ID NO: 137, CDRH2 comprende SEQ ID NO: 150, CDRH3 comprende SEQ ID NO: 166, CDRL1 comprende SEQ ID NO: 198, CDRL2 comprende SEQ ID NO: 216, y CDRL3 comprende SEQ ID NO: 233, (d) CDRH1 comprende SEQ ID NO: 147, CDRH2 comprende SEQ ID NO: 163, CDRH3 comprende…

Formulación de disolución rápida de cinacalcet.

Sección de la CIP Necesidades corrientes de la vida

(25/10/2017). Inventor/es: ALVAREZ,FRANCISCO J, LIN,HUNG-REN H, JU,TZUCHI R, LAWRENCE,GLEN CARY. Clasificación: A61K31/00, A61K31/135, A61K9/20, A61K31/137, A61K9/28, A61P5/18.

Composición farmacéutica que comprende (a) desde el 10 % hasta el 40 % en peso de cinacalcet HCI; (b) desde el 45 % hasta el 85 % en peso de al menos un diluyente, en la que el al menos un diluyente es una mezcla de celulosa microcristalina y almidón en una proporción en peso que oscila entre 1:1 y 15:1; y (c) desde el 1 % hasta el 5 % en peso de al menos un aglutinante, en la que el aglutinante se selecciona de povidona, hidroxipropilmetilcelulosa, dihidroxipropilcelulosa y carboximetilcelulosa de sodio; en la que el porcentaje en peso es en relación con el peso total de la composición.

PDF original: ES-2655435_T3.pdf

Anticuerpos de unión a receptor de CGRP humano.

(09/08/2017) Anticuerpo o fragmento de unión a antígeno del mismo que se une al receptor de CGRP humano que comprende una CDRH1, una CDRH2, una CDRH3, una CDRL1, una CDRL2 y una CDRL3, en el que: (a) CDRL1, CDRL2 y CDRL3 tienen la secuencia de SEQ ID NO: 42, 43 y 44, respectivamente, y CDRH1, CDRH2 y CDRH3 tienen la secuencia de SEQ ID NO: 73, 74 y 75, 5 respectivamente; (b) CDRL1, CDRL2 y CDRL3 tienen la secuencia de SEQ ID NO: 45, 46 y 47, respectivamente, y CDRH1, CDRH2 y CDRH3 tienen la secuencia de SEQ ID NO: 76, 77 y 78, respectivamente; (c) CDRL1, CDRL2 y CDRL3 tienen la secuencia de SEQ ID NO: 48, 49 y 50, respectivamente, y CDRH1, CDRH2 y CDRH3 tienen la secuencia de SEQ ID NO: 79, 80 y 81, respectivamente; (d) CDRL1, CDRL2 y CDRL3…

Uso del estado del virus del papiloma humano en el establecimiento del uso de un agente que se une a EGFr en el tratamiento del cáncer.

Sección de la CIP Física

(09/08/2017). Inventor/es: WIEZOREK,JEFFREY SCOTT, BACH,BRUCE ALLEN. Clasificación: G01N33/574, G01N33/74.

Metodo de prediccion de si un paciente que tiene un tumor se beneficiara de un tratamiento que comprende un agente que se une especificamente a un polipeptido de EGFr, que comprende determinar si el tumor del paciente es positivo para VPH o negativo para VPH, en el que si el tumor del paciente es negativo para VPH, se predice que el paciente se beneficia del tratamiento con un agente que se une especificamente a un polipeptido de EGFr, en el que el agente que se une especificamente a un polipeptido de EGFr es un anticuerpo frente a EGFr.

PDF original: ES-2639651_T3.pdf

Derivados de 6-([1,2,4]triazolo[4,3-a]piridin-3-ilmetil)-1,6-naftiridin-5(6H)-ona como inhibidores de c-Met.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(02/08/2017). Inventor/es: KIM, TAE, SEONG, YANG, KEVIN, NORMAN, MARK, H., LIU, LONGBIN, HUNGATE, RANDALL, W., HARMANGE, JEAN-CHRISTOPHE, BOOKER,SHON, STEC,MARKIAN, XI,NING, SIEGMUND,AARON,C, SPRINGER,STEPHANIE, BELLON,STEVEN, ROMERO,KARINA, ALBRECHT,Brian K, BOEZIO,Alessandro, CHOQUETTE,Deborah, BAUER,DAVID, D\'\'AMICO,DERIN, HIRAI,SATOKO, LEWIS,RICHARD T, LOHMAN,JULIA, BODE,CHRISTIANE M, POTASHMAN,MICHELLE, PETERSON,EMILY A, COPELAND,KATRINA W. Clasificación: C07D487/04, C07D493/04, C07D495/04, C07D471/04, C07D498/04, A61K31/4355.

Compuesto que se selecciona de: **Fórmula** o una sal del mismo.

PDF original: ES-2644873_T3.pdf

Mutaciones en K-ras y terapia con anticuerpos anti-EGFR.

Sección de la CIP Química y metalurgia

(12/07/2017). Inventor/es: FREEMAN,DANIEL, JUAN,TODD, RADINSKY,ROBERT. Clasificación: C12Q1/68.

Un método para predecir si un paciente que sufre de cáncer colorrectal no responderá al tratamiento con panitumumab, que comprende la determinación de la presencia o ausencia de una mutación T20M y G12V en K-ras en un tumor de dicho paciente, en donde la presencia de las mutaciones indica que el paciente no responderá al tratamiento con panitumumab.

PDF original: ES-2635051_T3.pdf

Moléculas de Fc modificadas.

(14/06/2017) Molécula que comprende un dominio Fc de IgG humana modificada de manera que comprende un péptido farmacológicamente activo en una región de bucle, estando dicha región de bucle en un dominio no terminal del dominio Fc de IgG, en la que el dominio Fc es un dominio Fc de IgG1 que comprende SEQ ID NO: 599 y el péptido farmacológicamente activo se inserta en H49/E50, Y77/N78, K107/A108 o L139/T140 de SEQ ID NO: 599; o el dominio Fc es un dominio Fc de IgG1 que comprende SEQ ID NO: 603 y el péptido farmacológicamente activo se inserta en H53/E54, Y81/N82, K111/A112 o L143/T144 de SEQ ID NO: 603; o el dominio Fc es un dominio Fc de IgG1 que comprende SEQ ID NO: 604 y el péptido farmacológicamente activo se inserta en H53/E54, Y81/N82, K111/A112 o M143/T144 de SEQ ID NO: 604; o el dominio Fc es un dominio Fc de lgG3 que comprende SEQ…

Proteínas de unión a antígeno humanas que se unen a beta-Klotho, receptores de FGF y complejos de los mismos.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(26/04/2017). Inventor/es: HU, SHAW-FEN, SYLVIA, FOLTZ,IAN, LI,YANG, KING,CHADWICK TERENCE, ARORA,TARUNA. Clasificación: C07K16/28, A61K39/395, C07K16/18, C07K19/00, C07K14/71, A61P3/04.

Anticuerpo aislado o fragmento del mismo que puede unirse a un complejo que comprende ß-Klotho y FGFR1c e induce senalizacion mediada por FGF21 y comprende las siguientes CDR: a) CDRH1: SEQ ID NO: 122; b) CDRH2: SEQ ID NO: 133; c) CDRH3: SEQ ID NO: 148; d) CDRL1: SEQ ID NO: 166; e) CDRL2: SEQ ID NO: 176; y f) CDRL3: SEQ ID NO: 188; para su uso en terapia.

PDF original: ES-2633810_T3.pdf

Mutantes de FGF21 y usos de los mismos.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(26/04/2017). Inventor/es: LI, YUE-SHENG, HECHT,RANDY,IRA, XU,Jing, SUN,JEONGHOON, MICHAELS,MARK LEO, BELOUSKI,EDWARD JOHN, ELLISON,MURIELLE MARIE, HAMBURGER,AGNES EVA. Clasificación: A61K38/18, C07K14/50.

Polipéptido que comprende una secuencia de aminoácidos de SEQ ID NO: 4, en el que: (a) el residuo en la posición 180 es ácido glutámico; (b) el residuo en la posición 171 es glicina; y (c) el residuo en la posición 98 es arginina, y en el que el polipéptido puede disminuir los niveles de glucemia en un mamífero.

PDF original: ES-2632742_T3.pdf

Formulaciones de anticuerpo a alta concentración.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(12/04/2017). Inventor/es: OSSLUND, TIMOTHY, D. Clasificación: A61K47/12, A61K39/395, C07K16/22.

Una formulación líquida estéril que tiene una viscosidad absoluta de 10 cP o menos que comprende: (a) una inmunoglobulina anti-esclerostina a una concentración de al menos 70 mg/ml; y (b) acetato de calcio a una concentración que oscila de 1 mM a 20 mM, donde la inmunoglobulina anti-esclerostina comprende secuencias de aminoácidos de SEQ ID NO: 86 y SEQ ID NO: 84.

PDF original: ES-2626033_T3.pdf

Proteínas de unión a antígeno humanas que se unen a beta-Klotho, receptores de FGF y complejos de los mismos.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(15/03/2017). Inventor/es: HU, SHAW-FEN, SYLVIA, FOLTZ,IAN, KING,CHADWICK,T, LI,YANG, ARORA,TARUNA. Clasificación: C07K16/28, A61K39/395, C07K16/18, C07K19/00, C07K14/71, A61P3/04.

Un anticuerpo aislado o fragmento del mismo que puede unirse a un complejo que comprende ß-Klotho y FGFR1c e induce senalizacion mediada por FGF21 y comprende las siguientes CDR: a) CDRH1: SEQ ID NO: 122; b) CDRH2: 5 SEQ ID NO: 133; c) CDRH3: SEQ ID NO: 148; d) CDRL1: SEQ ID NO: 166; e) CDRL2: SEQ ID NO: 176; y f) CDRL3: SEQ ID NO: 188.

PDF original: ES-2631135_T3.pdf

Agentes de unión a esclerostina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(22/02/2017). Inventor/es: LU, HSIENG, SEN, LATHAM,John, PASZTY,CHRISTOPHER, ROBINSON,MARTYN KIM, HENRY,ALISTAIR JAMES, HOFFMANN,KELLY SUE, LAWSON,ALASTAIR, WINKLER,DAVID, WINTERS,AARON GEORGE. Clasificación: A61K39/00, C07K16/18, C12N15/63, C07K16/22, C07K14/51.

Un método para producir un polipéptido que es una parte inmunogénica de esclerostina humana, que comprende las etapas de: a) tratar esclerostina para conseguir digestión tríptica completa; b) recoger la muestra de digestión tríptica que tiene el peso molecular promedio de 7122,0 Dalton (masa teórica de 7121,5 Dalton) como se determina por espectrometría de masas de cristal líquido de ionización de electropulverización o tiempo de retención de aproximadamente 20,6 minutos como se determina por elución de una columna de HPLC de fase inversa con gradiente lineal de ácido trifluoroacético (TFA) 0,05 % a acetonitrilo 90 % en TFA 0,05 % a un caudal de 0,2 ml/min; y c) purificar la parte inmunogénica.

PDF original: ES-2624643_T3.pdf

Cultivo de células de mamífero.

Sección de la CIP Química y metalurgia

(15/02/2017). Inventor/es: MORRIS, ARVIA, E., FOLLSTAD,BRIAN,D, McCOY,Rebecca,E. Clasificación: C12N5/10, C07K16/00, C12P21/00, C12N5/00.

Metodo de cultivo de celulas de mamifero que expresan una proteina recombinante que comprende; establecer un cultivo de celulas de mamifero en un medio de cultivo libre de suero en un biorreactor inoculando el biorreactor con al menos de 0,5x106 a 3,0x106 celulas/ml en un medio de cultivo libre de suero; hacer crecer las celulas de mamifero durante una fase de crecimiento y complementar el medio de cultivo con alimentaciones por bolo de un medio de alimentacion libre de suero comenzar la perfusion del o de aproximadamente el dia 5 al o a aproximadamente el dia 9 del cultivo celular, y mantener las celulas de mamifero durante una fase de produccion mediante perfusion con un medio de perfusion libre de suero, en el que el volumen celular empaquetado durante la fase de produccion es de menos del o igual al 35%.

PDF original: ES-2625045_T3.pdf

Terapia de combinación usando un inhibidor de IL-1 para tratar enfermedades mediadas por IL-1.

Sección de la CIP Necesidades corrientes de la vida

(25/01/2017). Inventor/es: BENDELE, ALISON, M., SENNELLO, REGINA, M. Clasificación: A61K31/505, A61P43/00, A61K45/06, A61P29/00, A61K31/519, A61K38/00, A61P19/02, A61K38/20.

Uso de cantidades terapéuticamente eficaces de un anticuerpo monoclonal anti-IL-1 y un fármaco antiinflamatorio adicional para la preparación de un medicamento para el tratamiento de una enfermedad inflamatoria aguda o crónica, donde dicho anticuerpo monoclonal anti-IL-1 y al menos un compuesto antiinflamatorio adicional se preparan para la administración separada o combinada, donde el compuesto antiinflamatorio es metotrexato (ácido N-[4-[(2,4-diamino-6-pteridinil)metilamino]benzoil]-L-glutámico).

PDF original: ES-2615357_T3.pdf

Agentes de unión a esclerostina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(18/01/2017). Inventor/es: LU, HSIENG, SEN, LATHAM,John, PASZTY,CHRISTOPHER, ROBINSON,MARTYN KIM, HENRY,ALISTAIR JAMES, HOFFMANN,KELLY SUE, LAWSON,ALASTAIR, WINKLER,DAVID, WINTERS,AARON GEORGE. Clasificación: A61K39/00, C07K16/18, C12N15/63, C07K16/22, C07K14/51.

Un polipéptido que consiste en al menos una, al menos dos, al menos tres o las cuatro secuencias de aminoácidos SEQ ID NO: 5, SEQ ID NO: 2, SEQ ID NO: 3 y SEQ ID NO: 4, en el que el polipéptido induce un anticuerpo específico para esclerostina de SEQ ID NO: 1 cuando el polipéptido se administra a un animal.

PDF original: ES-2620684_T3.pdf

Agentes de unión a esclerostina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(04/01/2017). Inventor/es: LU, HSIENG, SEN, LATHAM,John, PASZTY,CHRISTOPHER, ROBINSON,MARTYN KIM, HENRY,ALISTAIR JAMES, HOFFMANN,KELLY SUE, LAWSON,ALASTAIR, WINKLER,DAVID, WINTERS,AARON GEORGE. Clasificación: A61K38/17, A61K38/10, C07K14/51.

Un polipéptido que consiste en las secuencias de aminoácidos SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 y SEQ ID NO: 5, en el que SEQ ID NO: 2 y 4 están unidas por un enlace disulfuro en las posiciones de aminoácidos 57 y 111 en referencia a SEQ ID NO: 1, y SEQ ID NO: 3 y 5 están unidas por (a) un enlace disulfuro en las posiciones de aminoácidos 82 y 142 en referencia a SEQ ID NO: 1, y (b) un enlace disulfuro en las posiciones de aminoácidos 86 y 144 en referencia a SEQ ID NO: 1.

PDF original: ES-2619709_T3.pdf

Inhibidores duales tricíclicos condensados de CDK 4/6 y FLT3.

(28/12/2016) Compuesto de fórmula IIIA: **Fórmula** o la sal farmacéuticamente aceptable del mismo, el hidrato del mismo o la mezcla del mismo, en la que: R3a se selecciona de -H, -F o -Cl, -(alquilo C1-C3) u -O-(alquilo C1-C3); R3b es -H, halo, -OH, -O-(alquilo C1-C6), -(alquilo C1-C6) no sustituido, -NR'R", -C(≥O)-(alquilo C1-C6), -C(≥O)-O-(alquilo C1-C6), -C(≥O)-NR'R" o un -(alquilo C1-C6) sustituido, en el que el -(alquilo C1-C6) sustituido está sustituido con 1-3 sustituyentes seleccionados independientemente de halo, -OH, -OCH3, -CN o -NO2; R6 se selecciona de -H, -(alquilo C1-C6), -C(≥O)-(alquilo C1-C6), -C(≥O)-C(≥O)-OH,…

Anticuerpo monoclonal para la proteina de union a osteoprotegerina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(07/12/2016). Inventor/es: BOYLE, WILLIAM, J., DESHPANDE,RAJENDRA,V, HITZ,ANNA, SULLIVAN,John,K. Clasificación: A61P35/00, C12N15/13, C12N5/10, C07K14/705, C07K16/28, C12N15/09, A61K45/00, A61K39/395, A61P43/00, C12P21/08, A61K45/06, A61P29/00, C12N1/19, A61K38/22, A61P19/00, C12N1/21, A61P19/02, C07K14/52, A61P35/04, A61P19/10, A61P3/14, C12N1/15.

Un anticuerpo monoclonal o un dominio de unión a antígeno del mismo que se une a una porción de la secuencia de aminoácidos: GGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP (SEQ ID NO: 76) desde el resto de aminoácido 212 hasta el resto de aminoácido 250 de OPGbp (proteína de unión a osteoprotegerina) humana, en donde el anticuerpo o el dominio de unión a antígeno del mismo inhibe la formación o la activación de osteoclastos mediada por OPGbp humana.

PDF original: ES-2612124_T3.pdf

Polipéptidos receptores de activina variantes y usos de los mismos.

(30/11/2016) Una proteína aislada que comprende un polipéptido receptor de activina IIB variante (vActRIIB), en la que dicho polipéptido se selecciona entre el grupo que consiste en: (a) un polipéptido que tiene la secuencia polipeptídica expuesta en la SEQ ID NO: 18, excepto por una única sustitución de aminoácido en la posición 28, en el que la sustitución se selecciona entre una cualquiera de E por A, F, Q, V, I, L, M, K, H, W e Y; (b) un polipéptido que tiene la secuencia polipeptídica expuesta en los aminoácidos 19 a 134 de la SEQ ID NO: 18, excepto por una única sustitución de aminoácido en la posición 28, en el que la sustitución se selecciona entre una cualquiera de E por A, F, Q, V, I, L, M, K, H, W e Y; (c) un polipéptido…

Anticuerpos de unión a esclerostina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(30/11/2016). Inventor/es: LU, HSIENG, SEN, LATHAM,John, PASZTY,CHRISTOPHER, ROBINSON,MARTYN KIM, HENRY,ALISTAIR JAMES, HOFFMANN,KELLY SUE, LAWSON,ALASTAIR, WINKLER,DAVID, WINTERS,AARON GEORGE. Clasificación: A61K39/00, C07K16/18, C12N15/63, A61K38/17, A61K38/10, C07K16/22, C07K14/51.

Un anticuerpo monoclonal que se une con esclerostina humana de SEQ ID NO: 1 con una constante de disociación de menos de o igual a 1 x 10-9 M como se determinó por resonancia de plasmón superficial y aumenta al menos uno de formación de hueso, densidad mineral ósea, contenido mineral óseo, masa ósea, calidad ósea y fuerza ósea en un mamífero; y a) comprende CDR-L1 de SEQ ID NO: 48, CDR-L2 de SEQ ID NO: 49, CDR-L3 de SEQ ID NO: 50, CDR-H1 de SEQ ID NO: 45, CDR-H2 de SEQ ID NO: 46 y CDR-H3 de SEQ ID NO: 47; b) comprende CDR-L1 de SEQ ID NO: 42, CDR-L2 de SEQ ID NO: 43, CDR-L3 de SEQ ID NO: 44, CDR-H1 de SEQ ID NO: 39, CDR-H2 de SEQ ID NO: 40 y CDR-H3 de SEQ ID NO: 41; o c) bloquea de forma cruzada la unión de dicho anticuerpo de (a) o (b) con esclerostina humana de SEQ ID NO: 1 o se bloquea de forma cruzada la unión con esclerostina humana de SEQ ID NO: 1 por dicho anticuerpo de (a) o (b), en el que el bloqueo cruzado se determina por resonancia de plasmón superficial o ELISA.

PDF original: ES-2616985_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · 9 · 10 · ››

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015