CIP 2015 : A61K 38/26 : Glucagón.

CIP2015AA61A61KA61K 38/00A61K 38/26[4] › Glucagón.

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).

A61K 38/26 · · · · Glucagón.

CIP2015: Invenciones publicadas en esta sección.

Composición farmacéutica para tratar un síndrome metabólico.

(11/03/2019). Solicitante/s: SANOFI. Inventor/es: HABERMANN, PAUL, SCHAEFER, HANS-LUDWIG, RAO, ERCOLE, DREYER,MATTHIAS, SOMMERFELD,MARK, BOSCHEINEN,OLIVER.

Una composición farmacéutica que contiene al menos un compuesto FGF-21 (factor de crecimiento de fibroblastos 21) y al menos un agonista del GLP-1R (receptor del péptido 1 similar al glucagón) para su uso en el tratamiento de diabetes, comprendiendo adicionalmente la composición farmacéutica un vehículo, diluyente o excipiente farmacéuticamente aceptable seleccionado del grupo que consiste en agua estéril, disolución salina que contiene alcohol bencílico aproximadamente al 0,9% en mg/ml, disolución de Hank, lactato de Ringer, lactosa, dextrosa, sacarosa, trealosa, sorbitol y manitol.

PDF original: ES-2703581_T3.pdf

Formulaciones de péptidos que contienen propilenglicol que son óptimas para la producción y para su uso en dispositivos de inyección.

(06/03/2019). Ver ilustración. Solicitante/s: NOVO NORDISK A/S. Inventor/es: ENGELUND,DORTHE,KOT, BONDE,Claude, PEDERSEN,TINA BJELDSKOV.

Una formulación farmacéutica que comprende el péptido Arg34, Lys26(N-ε-(γ-Glu(N-α-hexadecanoil))-GLP-1 y propilenglicol, en donde dicho propilenglicol está presente en dicha formulación en una concentración final de 5 mg/ml a 50 mg/ml, y en donde dicha formulación tiene un pH de 7,0 a 10,0.

PDF original: ES-2727854_T3.pdf

Un conjugado de GLP-2 de sitio específico que usa un fragmento de inmunoglobulia.

(06/03/2019). Solicitante/s: Hanmi Science Co., Ltd. . Inventor/es: KWON, SE CHANG, JUNG, SUNG YOUB, KIM,SEUNG SU, LIM,SE YOUNG.

Un conjugado de péptido 2 de tipo glucagón (GLP-2) que comprende GLP-2 nativo o su derivado y un fragmento Fc de inmunoglobulina que se une covalentemente a través de un polímero no peptidilo, en el que el GLP- 2 nativo o su derivado tiene un grupo tiol introducido en su extremo C-terminal, y un extremo del polímero no peptidilo está unido al grupo tiol del GLP-2 o su derivado, en el que el derivado de GLP-2 se prepara por sustitución, eliminación o modificación del grupo amina N-terminal de un GLP-2 nativo y tiene la función de unirse a un receptor de GLP-2.

PDF original: ES-2725805_T3.pdf

Conjugado de oligómero de ácido biliar para un nuevo transporte vesicular y uso del mismo.

(20/02/2019). Solicitante/s: ST Pharm Co., Ltd. Inventor/es: KIM, KYUNGJIN, BYUN,YOUNG RO, AHMED,AL-HILAL TASLIM, JEON,OK CHEOL, MOON,HYUN TAE, YUN,YISUK.

Un método para la preparación de un conjugado de macromolécula-oligómero de ácido biliar específico de sitio terminal, que comprende: (a) preparar un oligómero de ácido biliar mediante la oligomerización de dos o más monómeros de ácidos biliares; y (b) conjugar el oligómero de ácido biliar preparado en la etapa (a) con el sitio terminal de una macromolécula; en el que la macromolécula es un polisacárido.

PDF original: ES-2701077_T3.pdf

Derivados de GLP-1 doblemente acilados.

(09/01/2019) Un derivado de un análogo de GLP-1, dicho análogo comprende un primer residuo K en una posición correspondiente a la posición 27 de GLP-1 (sec. con núm. de ident.: 1); un segundo residuo K en una posición correspondiente a la posición 37 de GLP-1 ; y un máximo de diez cambios de aminoácidos en comparación con GLP-1 ; en donde el primer residuo K se designa K27, y el segundo residuo K se designa K37; dicho derivado comprende dos porciones de prolongación unidas a K27 y K37, respectivamente, por medio de un enlazador, en donde la porción de prolongación se selecciona del Químico 2 y Químico 1: Químico 2: HOOC-C6H4-O-(CH2)y-CO-* Químico 1: HOOC-(CH2)x-CO-*, en donde x es un número entero en el intervalo de 6-16 y "y" es un número entero en el intervalo de 3-17; y el enlazador comprende el Químico 5: …

Nuevos derivados de oxintomodulina y composición farmacéutica para el tratamiento de obesidad que lo comprende.

(30/11/2018). Solicitante/s: Hanmi Science Co., Ltd. . Inventor/es: KWON, SE CHANG, JUNG, SUNG YOUB, PARK,Young,Jin, PARK,YOUNG KYUNG, JANG,MYUNG HYUN, SHEN,LING AI.

Un péptido que comprende una secuencia de aminoácidos de una cualquiera de las SEQ ID NO: 24, 25, o 26.

PDF original: ES-2692187_T3.pdf

Composiciones de péptidos GLP-1 y preparación de estas.

(21/11/2018). Solicitante/s: NOVO NORDISK A/S. Inventor/es: ELIASEN,HELLE, VILHELMSEN,THOMAS, HANSEN,TUE.

Una composición farmacéutica que comprende un primer tipo de gránulos y un segundo tipo de gránulos, en donde dicho primer tipo de gránulos comprende una sal de ácido N-(8-(2-hidroxibenzoil)amino)caprílico y ningún péptido GLP-1, y en donde dicho segundo tipo de gránulos comprende un péptido GLP-1 y ninguna sal de ácido N-(8-(2-hidroxibenzoil)amino)caprílico, y en donde dicha composición se encuentra en la forma de una forma de dosificación sólida seleccionada del grupo que consiste en un comprimido, una cápsula y una bolsita.

PDF original: ES-2690553_T3.pdf

Formulaciones de insulina de acción prolongada.

(20/11/2018). Solicitante/s: SANOFI. Inventor/es: WERNER, ULRICH, DR., LOOS, PETRA, MUELLER, WERNER, BECKER, REINHARD, DR., BODERKE,PETER, FUERST,CHRISTIANE DR, TERTSCH,KATRIN DR, SCHOETTLE,ISABELL, FRICK,ANNKE.

Una formulación farmacéutica acuosa con pH entre 3,4 y 4,6 que comprende insulina glargina, en donde la concentración de insulina glargina es de 200-500 U/mL, que es equimolar a 200-500 UI de insulina humana.

PDF original: ES-2690302_T3.pdf

Microcápsulas de liberación sostenida basadas en poli(lactida-co-glicólido) que comprenden un polipéptido y un azúcar.

(15/11/2018) Un proceso para preparar una composición farmacéuticamente aceptable en forma de micropartículas para la liberación sostenida de exendina-4, que comprende: a) formar una mezcla combinando una fase acuosa que comprende polipéptido de exendina-4 hidrosoluble y sacarosa, con una fase oleosa que comprende un polímero biocompatible y un disolvente para el polímero biocompatible; b) formar una emulsión de agua en aceite de la mezcla de la etapa a), en donde el tamaño de las gotas de la emulsión interna es de aproximadamente 0,1 a aproximadamente 1,2 micrómetros; c) añadir un agente de coacervación a la mezcla para formar micropartículas embrionarias, en donde el agente de coacervación es aceite de silicona añadido…

Análogos de glucagón acilados.

(06/11/2018) Un compuesto que tiene la fórmula: R1-P1-P2-R2 en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoílo o trifluoroacetilo; R2 es OH o NH2; P1 es un péptido que tiene la secuencia: His-X2-X3-GTFTSDYSKYL-X15-X16-X17-X18-A-X20-DFI-X24-WLE-X28-A en la que: X2 se selecciona entre Aib, Ac3c, Ac4c y Ac5c; X3 se selecciona entre Gln y His; X15 se selecciona entre Asp y Glu; X16 se selecciona entre Glu y ψ ; X17 se selecciona entre Arg y ψ ; X18 se selecciona entre Ala y Arg; X20 se selecciona entre Lys y His; X24 se selecciona entre Glu y ψ ; X28 se selecciona entre Ser y ψ ; y P2 está ausente o es una secuencia de 1-20 unidades de aminoácidos seleccionados independientemente entre el grupo que consiste en Ala, Leu, Ser, Thr, Tyr, Cys, Glu,…

Derivados de exendina-4 como agonistas duales de GLP1/GIP o trigonales de GLP1/GIP/glucagón.

(02/11/2018) Un compuesto peptídico que tiene la fórmula (I): R1-Z-R2 (I) en la que Z es un resto de péptido que tiene la fórmula (II) Tyr-Aib-X3-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-X12-Gln-X14-X15-X16-X17-5 X18-X19-X20-X21-Phe- Ile-Glu-Trp-Leu-Lys-X28-X29-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-X(II) X3 representa Glu, X12 representa un resto de aminoácido seleccionado de Ile y Lys, X14 representa un resto de aminoácido que tiene una cadena lateral con un grupo -NH2, en el que el grupo de cadena lateral -NH2 está funcionalizado por -C(O)-R5, en la que R5 puede ser un resto que comprende hasta 50 o hasta…

Dosificación oral de compuestos de GLP-1.

(02/11/2018). Solicitante/s: NOVO NORDISK A/S. Inventor/es: SAUERBERG, PER, NIELSEN,FLEMMING SEIER.

Una composición sólida que comprende un péptido GLP-1 y un potenciador para usar como un medicamento mediante la administración oral, en donde a) dicho péptido tiene una vida media plasmática, en humanos, de al menos 60 horas; b) dicha composición se administra al menos, 3 veces; y c) dicha composición se administra de manera que la relación entre la vida media plasmática en días de dicho péptido en humanos y el intervalo de dosificación en días de dicha composición es más de 2:1.

PDF original: ES-2688462_T3.pdf

Composiciones de péptido-2 similar a glucagón y métodos para producir y usar los mismos.

(26/10/2018). Solicitante/s: Amunix Operating Inc. Inventor/es: SCHELLENBERGER, VOLKER, STEMMER,WILLEM P, WANG,CHIA-WEI, SILVERMAN,JOSHUA, SPINK,BENJAMIN, GEETHING,NATHAN.

Una composición para su uso en el tratamiento de la enteritis en un sujeto mamífero logrando un efecto intestinotrófico, comprendiendo la composición una proteína de fusión que comprende: (i) una secuencia de proteína-2 similar a glucagón (GLP-2) que consiste en la secuencia: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD y (ii) un polipéptido recombinante extendido (XTEN), en donde el XTEN es la secuencia AE864 de la tabla 4; en donde dicha composición muestra un efecto intestinotrófico cuando se administra al sujeto con enteritis que es al menos un 100% o al menos un 120% o al menos un 150% o al menos un 200% del efecto intestinotrófico comparado con el GLP-2 correspondiente no unido a XTEN tras la administración de dicho GLP-2 correspondiente a un sujeto comparable usando una dosis comparable.

PDF original: ES-2687651_T3.pdf

NANOCONJUGADOS FORMADOS POR MOLÉCULAS DENDRÍTICAS Y PÉPTIDOS COMO AGENTES ANTITUMORALES FRENTE AL CÁNCER.

(09/08/2018). Solicitante/s: UNIVERSIDAD DE ALCALA.. Inventor/es: GOMEZ RAMIREZ,RAFAEL, SANCHEZ-NIEVES FERNANDEZ,JAVIER, MUÑOZ MORENO,Laura, DE LA MATA DE LA MATA,F. Javier, SANCHEZ MILLA,María, CARMENA SIERRA,Mª José.

La presente invención se refiere a la formación de nanoconjugados que presentan actividad antitumoral, principalmente frente al cáncer de próstata avanzado,pero sin descartar otros. Los nanoconjugados están formados por sistemas dendríticos (dendrímeros o dendrones) y neuropéptidos. Las moléculas dendríticas son principalmente de estructura carbosilano con funciones amonio en la periferia. Los péptidos son preferentemente de la familia glucagón/secretina (ej.: VIP, GHRH, PACAP). La combinación de estos dos sistemas da lugar a un nanoconjugado con propiedades anticancerígenas, diferentes a las de sus precursores por separado. La actividad antitumoral se refleja en la inhibición de crecimiento y muerte de células tumorales de cáncer de próstata avanzado (PC3) y además estos nanoconjugados favorecen la adhesión celular y evitan procesos de migración de las células tumorales, es decir, procesos de metástasis.

Nanoconjugados formados por moléculas dendríticas y péptidos como agentes antitumorales frente al cáncer.

(31/07/2018) Nanoconjugados formados por moléculas dendríticas y péptidos como agentes antitumorales frente al cáncer La presente invención se refiere a la formación de nanoconjugados que presentan actividad antitumoral, principalmente frente al cáncer de próstata avanzado, pero sin descartar otros. Los nanoconjugados están formados por sistemas dendríticos (dendrímeros o dendrones) y neuropéptidos. Las moléculas dendríticas son principalmente de estructura carbosilano con funciones amonio en la periferia. Los péptidos son preferentemente de la familia glucagón/secretina (ej.: VIP, GHRH, PACAP). La combinación de estos dos sistemas da lugar a un nanoconjugado con propiedades anticancerígenas, diferentes a las de sus precursores por separado. La actividad antitumoral se refleja…

Composición farmacéutica que comprende un agonista de GLP-1, una insulina y metionina.

(04/04/2018). Solicitante/s: SANOFI-AVENTIS DEUTSCHLAND GMBH. Inventor/es: MULLER, WERNER, DR., TERTSCH,KATRIN DR, SCHOETTLE,ISABELL, HAUCK,GERRIT, HAGENDORF,ANNIKA, SIEFKE-HENZLER,VERENA.

Composición líquida que comprende 0,01 a 1,5 mg/ml, preferiblemente 0,01 a 0,5 mg/ml, de agonistas de GLP-1 y/o una sal farmacológicamente tolerable de los mismos, 240 - 3000 nmol/ml de insulina y/o una sal farmacológicamente tolerable de la misma y, eventualmente, al menos un coadyuvante farmacéuticamente aceptable, caracterizada por que contiene 0,5-20 mg/ml de metionina.

PDF original: ES-2676373_T3.pdf

Formulaciones de insulina de acción prolongada.

(04/04/2018). Solicitante/s: SANOFI. Inventor/es: WERNER, ULRICH, DR., LOOS, PETRA, MUELLER, WERNER, BECKER, REINHARD, DR., BODERKE,PETER, HAHN,ANNKE DR, FUERST,CHRISTIANE DR, TERTSCH,KATRIN DR.

Una formulación farmacéutica acuosa con un pH entre 3,4 y 4,6 que comprende insulina glargina, en donde la formulación comprende 270-330 U/mL de insulina glargina, que es equimolar a 270-330 UI de insulina humana.

PDF original: ES-2676401_T3.pdf

Métodos y composiciones para la administración oral de proteínas.

(21/03/2018). Solicitante/s: ORAMED PHARMACEUTICALS INC. Inventor/es: KIDRON,MIRIAM.

Una composición que comprende una proteína que tiene un peso molecular de hasta 100.000 Daltons, un inhibidor de tripsina, un ácido graso omega-3, y EDTA.

PDF original: ES-2670856_T3.pdf

Derivados del péptido-1 similar al glucagón y su uso farmacéutico.

(14/03/2018) Un derivado de GLP-1 que comprende una secuencia de GLP-1 modificada que tiene: un total de 2-12 modificaciones de aminoácidos en comparación con GLP-1 (sec. con núm. de ident.: 1), que tiene la secuencia de la fórmula (I): Xaa7-Xaa8-Xaa9-Gly-Thr-Phe-Thr-Ser-Asp-Xaa16-Ser-Xaa18-Tyr- Xaa20- Glu-Glu-Xaa23- Xaa24-Xaa25-Arg- Xaa27-Xaa28-Ile-Xaa30 -Xaa31-Leu-Xaa33-Xaa34-Xaa35- Xaa36 -Xaa37 -Xaa38- Xaa39-Xaa40- Xaa41-R fórmula (I) (sec. con núm. de ident.: 2) en donde (Xaa7 - Xaa8) es (L-histidina-Aib), (desamino-histidina-alanina), o (desamino-histidina-Aib); Xaa9 es Glu; Xaa16 es Val, o Leu; Xaa18 es Ser, Lys, Cys, o Arg; Xaa20 es Leu, o Lys; Xaa23 es Gln, Glu, Lys, Cys, o Arg; Xaa24…

Péptidos de la superfamilia de glucagón que muestran actividad de receptor de glucocorticoides.

(07/03/2018). Solicitante/s: INDIANA UNIVERSITY RESEARCH AND TECHNOLOGY CORPORATION. Inventor/es: YANG, BIN, DIMARCHI, RICHARD D..

Compuesto que comprende la estructura Q-L-Y; en el que Q es un péptido de la superfamilia del glucagón; y en el que L-Y comprende la estructura (I):**Fórmula** en la que 20 L está unido a una cadena lateral que contiene amino o tiol de un aminoácido de Q correspondiente a la posición 40 de un análogo de glucagón natural modificado para comprender una extensión C-terminal de GPSSGAPPPS (SEQ ID NO: 1610), en el que dicha extensión C-terminal representa las posiciones de aminoácidos 30-39; o**Fórmula** en la que L está unido a una cadena lateral que contiene tiol de un aminoácido de Q correspondiente a la posición 40 de un análogo de glucagón natural modificado para comprender una extensión C-terminal de GPSSGAPPPS (SEQ ID NO: 1610), en el que dicha extensión C-terminal representa las posiciones de aminoácidos 30-39, e y es alquileno C1- C10, y dicho compuesto comprende la estructura**Fórmula**.

PDF original: ES-2672880_T3.pdf

Composición para administración transnasal y método para prepararla.

(21/02/2018). Solicitante/s: DAIICHI SANKYO COMPANY, LIMITED. Inventor/es: TAKEDA, SHUJI, MATSUMOTO, MASARU, NOBORI,KYOHEI.

Una composición en polvo para administración nasal que comprende un péptido fisiológicamente activo y acetato de celulosa como base, en donde la composición se obtiene 1) mezclando el péptido fisiológicamente activo, el acetato de celulosa y al menos un 20% en peso de agua en relación con el acetato de celulosa, y 2) secando la mezcla, y en donde el grado de acetilación del acetato de celulosa es de 32-40% y el péptido fisiológicamente activo es un péptido con un peso molecular no mayor que 20.000.

PDF original: ES-2663335_T3.pdf

Composición farmacéutica que comprende desPro36exendina-4(1-39)-Lys6-NH2 y metionina.

(24/01/2018). Solicitante/s: SANOFI-AVENTIS DEUTSCHLAND GMBH. Inventor/es: MULLER, WERNER, DR., BRUNNER-SCHWARZ,ANETTE, SIEFKE-HENZLER,VERENA.

Composición líquida que comprende desPro36exendina-4 -Lys6-NH2 y/o una sal de la misma tolerable desde el punto de vista farmacológico, y opcionalmente al menos un aceptable desde el punto de vista farmacéutico, caracterizada por que contiene metionina y está exenta de EDTA e histidina, y por que la composición contiene desPro36exendina-4 -Lys6-NH2 en una cantidad de 0,01 mg/mL a 1,5 mg/mL.

PDF original: ES-2667069_T3.pdf

Composiciones sólidas que comprenden un agonista de GLP-1 y una sal del ácido N-(8-(2-hidroxibenzoil)amino)caprílico.

(13/12/2017). Solicitante/s: NOVO NORDISK A/S. Inventor/es: SAUERBERG, PER, BJERREGAARD,SIMON, NIELSEN,FLEMMING SEIER.

Una composición sólida para la administración oral que comprende un agonista de GLP-1 y una sal del ácido N-(8-(2-hidroxibenzoil)amino)caprílico, donde la cantidad de dicha sal del ácido N-(8-(2-hidroxibenzoil)amino)caprílico es de al menos 0.6 mmol y donde dicho agonista de GLP-1 es semaglutida.

PDF original: ES-2661676_T3.pdf

Preconcentrado lipídico de liberación sostenida de sustancia farmacológicamente activa y composición farmacéutica que comprende el mismo.

(06/12/2017). Solicitante/s: CHONG KUN DANG PHARMACEUTICAL CORP. Inventor/es: KO,JIN YOUNG, PARK,SO HYUN, AN,SUNG WON, KI,MIN HYO, KIM,JI YEON.

Un preconcentrado lipídico de liberación sostenida, que comprende: a) un éster de ácido graso insaturado de sorbitano con al menos dos o más grupos -OH (hidroxilo) en una cabeza polar; b) un fosfolípido; y c) un endurecedor de cristal líquido, libre de un grupo ionizable, que tiene un resto hidrófobo de 15 a 40 átomos de carbono con un grupo triacilo o una estructura de anillo de carbono, donde el preconcentrado lipídico existe como un estado líquido en ausencia de un fluido acuoso y se transforma del estado líquido a un cristal líquido de tipo gel en presencia de un fluido acuoso.

PDF original: ES-2661487_T3.pdf

Formulaciones peptídicas que contienen propilenglicol que son óptimas para la producción y para el uso en dispositivos de inyección.

(22/11/2017). Solicitante/s: NOVO NORDISK A/S. Inventor/es: ENGELUND,DORTHE,KOT, BONDE,Claude, PEDERSEN,TINA BJELDSKOV.

Una formulación farmacéutica que comprende el péptido Arg34, Lys26(Nε-(γ-Glu(Nα-hexadecanoil)))-GLP-1 y propilenglicol, donde dicho propilenglicol se encuentra presente en dicha formulación en una concentración final de desde 1 mg/mL hasta 100 mg/mL y donde dicha formulación tiene un pH de desde 7.0 hasta 10.0.

PDF original: ES-2660320_T3.pdf

Agentes de administración de ácido fenilalquilcarboxílico.

(01/11/2017). Solicitante/s: EMISPHERE TECHNOLOGIES, INC.. Inventor/es: GSCHNEIDNER, DAVID, PUSZTAY,STEPHEN V.

Una composición que comprende: (A) al menos un agente biológicamente activo; y (B) al menos un compuesto de agente de administración representado por la fórmula I **(Ver fórmula)** o una sal farmacéuticamente aceptable del mismo, en la que el agente de administración está opcionalmente conjugado con un polímero mediante un grupo de unión seleccionado del grupo que consiste en -NHC(O)NH-, -C(O)NH-,-NHC(O)-; -OOC-, -COO-, -NHC(O)O-, - OC(O)NH-, -CH2NH -NHCH2-, -CH2NHC(O)O-, -OC(O)NHCH2-,-CH2NHCOCH2O-, -OCH2C(O)NHCH2-, - NHC(O)CH2O-, OCH2C(O)NH-, -NH-, -O- y enlaces carbono-carbono, n es 1-12, y R1-R5 son independientemente hidrógeno, un grupo alquilo C1-C6, alquenilo C2-C4, halo, alcoxi-C1-C4, hidroxilo, ariloxi C6-C14 o alquilhalo C1-C6, con la condición de que al menos uno de R1-R5 es metilo, metoxi, alquiloxi, hidroxi o halógeno.

PDF original: ES-2657484_T3.pdf

Agonistas duales de GLP1/GIP o trigonales de GLP1/GIP/glucagón.

(18/10/2017) Un compuesto peptídico que tiene la fórmula (I): R1-Z-R2 (I) en la que Z es un resto de péptido que tiene la fórmula (II) **Fórmula** X3 representa un resto de aminoácido seleccionado de Gln, Glu e His, X12 representa un resto de aminoácido seleccionado de Ile y Lys, X14 representa un resto de aminoácido que tiene una cadena lateral con un grupo -NH2, en el que el grupo de cadena lateral -NH2 está funcionalizado por -C(O)-R5, en la que R5 puede ser un resto que comprende hasta 50 o hasta 100 átomos de carbono y opcionalmente heteroátomos seleccionados de halógeno, N, O, S y/o P, X15 representa un resto de aminoácido seleccionado de Asp y Glu, X16 representa un resto de aminoácido seleccionado de Ser, Lys, Glu y Gln, X17 representa un resto de aminoácido seleccionado de Arg, Lys, Glu, Gln, Leu, Aib,…

Péptidos de la superfamilia de glucagón que muestran actividad de receptor nuclear de hormona.

(27/09/2017). Solicitante/s: INDIANA UNIVERSITY RESEARCH AND TECHNOLOGY CORPORATION. Inventor/es: YANG, BIN, DIMARCHI, RICHARD D., FINAN,BRIAN.

Compuesto que comprende la estructura Q-L-Y; en el que Q es un péptido de la superfamilia de glucagón que tiene actividad agonista en el receptor de glucagón, el receptor de GIP, el receptor de GLP-1, o una combinación de los mismos; Y es un esteroide que activa un receptor nuclear de hormona de Tipo I, en el que Y tiene un peso molecular de hasta aproximadamente 1.000 daltons; y L es un grupo enlazador o un enlace.

PDF original: ES-2661228_T3.pdf

Métodos y composiciones para la administración oral de exenatida.

(20/09/2017). Solicitante/s: Oramed Ltd. Inventor/es: KIDRON,MIRIAM.

Una composición que comprende una exenatida, un inhibidor de proteasa y un ácido graso omega-3, en donde dicha composición es una composición farmacéutica oral y no comprende un segundo inhibidor de proteasa, para su uso en el tratamiento de la diabetes mellitus.

PDF original: ES-2645588_T3.pdf

Rápido establecimiento y/o terminación de la administración sustancial de fármaco en estado estacionario.

(06/09/2017) Exenatida para su uso en un método de tratamiento de la diabetes mellitus de tipo 2 en un sujeto, en donde el sujeto es un ser humano, comprendiendo el tratamiento: proporcionar la administración continua de la exenatida desde un dispositivo de administración osmótica, teniendo la exenatida la secuencia de aminoácidos de exendina-4 y comprendiendo el dispositivo de administración osmótica: un depósito impermeable que comprende superficies interior y exterior y primer y segundo extremos abiertos; una membrana semi-permeable en relación de sellado con el primer extremo abierto del depósito; un motor osmótico dentro del…

Combinación de una insulina y un agonista de GLP-1.

(06/09/2017). Solicitante/s: SANOFI-AVENTIS DEUTSCHLAND GMBH. Inventor/es: SMITH, CHRISTOPHER JAMES, WERNER, ULRICH, DR., ROTTHÄUSER,BÄRBEL.

Medicamento que comprende una primera composición farmacéutica y una segunda composición farmacéutica, y en caso dado al menos otra composición farmacéutica, que comprenden respectivamente 100 U/ml de Gly(A21)- Arg(B31)-Arg(B32)-insulina humana y 20 a 150 μg/ml de desPro36exendina-4 -Lys6-NH2 y contienen Gly(A21)- Arg(B31)-Arg(B32)-insulina humana y desPro36exendina-4 -Lys6-NH2 en diferentes proporciones ponderales, referidas al peso total de la composición.

PDF original: ES-2650621_T3.pdf

Cápsulas que contiene composiciones líquidas basadas en aceite de agentes terapéuticos combinados para tratar la diabetes.

(30/08/2017) Una composición farmacéutica oral, comprendiendo la composición (a) una formulación líquida basada en aceite, comprendiendo dicha composición farmacéutica oral una insulina, un análogo de GLP-1, un inhibidor de tripsina y un agente quelante de cationes divalentes, en donde dicha formulación líquida basada en aceite está rodeada por un recubrimiento que resiste la degradación en el estómago; o (b) una combinación de i) una primera formulación líquida basada en aceite, comprendiendo dicha primera formulación líquida basada en aceite una insulina, un inhibidor de tripsina y un agente quelante de cationes divalentes; y ii) una segunda formulación líquida basada…

1 · · 3 · 4 · ››

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015