CIP-2021 : A61K 38/00 : Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00;

dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).

CIP-2021AA61A61KA61K 38/00[m] › Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".
Notas[n] de A61K 38/00:
  • Los términos o expresiones utilizados en el presente grupo siguen exactamente las definiciones dadas en la nota (1) que sigue al título de la subclase C07K .
  • Las preparaciones que contienen fragmentos de péptidos o péptidos modificados por eliminación o adición de aminoácidos, por sustitución de aminoácidos por otros o por combinación de estas modificaciones están clasificadas con las preparaciones que contienen péptidos padres. Sin embargo, las preparaciones que contienen fragmentos de péptidos que tienen cuatro o menos de cuatro aminoácidos están igualmente clasificadas en los grupos A61K 38/05 - A61K 38/07 .
  • Las preparaciones que contienen péptidos preparados por tecnología de ADN recombinante no están clasificadas según el huésped sino según el péptido original expresado, p. ej. las preparaciones que contienen un péptido HIV expresado en E. coli están clasificadas con las preparaciones que contienen péptidos HIV.

A61K 38/01 · Proteínas hidrolizadas; Sus derivados.

A61K 38/02 · Péptidos de número indeterminado de aminoácidos; Sus derivados.

A61K 38/03 · Péptidos que tienen hasta 20 aminoácidos en una secuencia indeterminada o parcialmente determinada; Sus derivados.

A61K 38/04 · Péptidos que tienen hasta 20 aminoácidos en una secuencia totalmente determinada; Sus derivados (gastrinas A61K 38/16, somatostatinas A61K 38/31, melanotropinas A61K 38/34).

A61K 38/05 · · Dipéptidos.

A61K 38/06 · · Tripéptidos.

A61K 38/07 · · Tetrapéptidos.

A61K 38/08 · · Péptidos que tienen de 5 a 11 aminoácidos.

A61K 38/09 · · · Hormona que libera a la hormona luteinizante [LHRH]; Péptidos relacionados.

A61K 38/095 · · · Oxitocinas; Vasopresinas; Péptidos relacionados.

A61K 38/10 · · Péptidos que tienen de 12 a 20 aminoácidos.

A61K 38/12 · · Péptidos cíclicos.

A61K 38/13 · · · Ciclosporinas.

A61K 38/14 · · Péptidos que contienen radicales sacárido; Sus derivados.

A61K 38/15 · · Depsipéptidos; Sus derivados.

A61K 38/16 · Péptidos que tienen más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.

A61K 38/17 · · que provienen de animales; que provienen de humanos.

A61K 38/18 · · · Factores de crecimiento; Reguladores de crecimiento.

A61K 38/19 · · · Citoquinas; Linfoquinas; Interferones.

A61K 38/20 · · · · Interleuquinas.

A61K 38/21 · · · · Interferones.

A61K 38/22 · · · Hormonas (derivados de pro-opiomelanocortina, pro-encefalina o pro-dinorfina A61K 38/33, p. ej. corticotropina A61K 38/35).

A61K 38/23 · · · · Calcitoninas.

A61K 38/24 · · · · Hormona folículo-estimulante [FSH]; Gonadotropinas coriónicas, p. ej.: HCG; Hormona luteinizante [LH]; Hormona estimulante de la tiroides [TSH].

A61K 38/25 · · · · Factor que libera a la hormona de crecimiento [GH-RF] (Somatoliberina).

A61K 38/26 · · · · Glucagón.

A61K 38/27 · · · · Hormona de crecimiento [GH] (Somatotropina).

A61K 38/28 · · · · Insulinas.

A61K 38/29 · · · · Hormona paratiroidea (paratormona); Péptidos derivados de la hormona paratiroidea.

A61K 38/30 · · · · Factores de crecimiento análogos a la insulina (somatomedinas), p. ej. IGF-1, IGF-2.

A61K 38/31 · · · · Somatostatinas.

A61K 38/32 · · · · Timopoietinas.

A61K 38/33 · · · derivados de pro-opiomelanocortina, pro-encefalina o pro-dinorfina.

A61K 38/34 · · · · Hormona melanotropa [MSH], p. ej. alfa o beta-melanotropina.

A61K 38/35 · · · · Corticotropina [ACTH].

A61K 38/36 · · · Factores de coagulación sanguínea o de fibrinolisis.

A61K 38/37 · · · · Factores VIII.

A61K 38/38 · · · Albúminas.

A61K 38/39 · · · Péptidos del tejido conectivo, p. ej. colágeno, elastina, laminina, fibronectina, vitronectina, globulina insoluble en frío [CIG].

A61K 38/40 · · · Transferrinas, p. ej. lactoferrinas, ovotransferrinas.

A61K 38/41 · · Péptidos que contienen ciclos porfirina o corrina.

A61K 38/42 · · · Hemoglobinas; Mioglobinas.

A61K 38/43 · · Enzimas; Proenzimas; Sus derivados.

Notas[n] de A61K 38/43:
  • En el presente grupo:
    • las proenzimas están clasificadas con las enzimas correspondientes;
    • las categorías previstas más abajo para las enzimas siguen en principio las de la "Nomenclatura y Clasificación de enzimas" de la Comisión Internacional para las enzimas. Cuando proceda, la designación de estas categorías figura entre paréntesis en los grupos siguientes.

A61K 38/44 · · · Oxidoreductasas (1).

A61K 38/45 · · · Transferasas (2).

A61K 38/46 · · · Hidrolasas (3).

A61K 38/47 · · · · que actúan sobre compuestos glicosílicos (3.2), p. ej. celulosas, lactasas.

A61K 38/48 · · · · que actúan sobre enlaces peptídicos (3.4).

A61K 38/49 · · · · · Uroquinasa; Activador de plasminógeno.

A61K 38/50 · · · · que actúan sobre enlaces carbono-nitrógeno distintos de los enlaces peptídicos (3.5), p. ej.: asparaginasa.

A61K 38/51 · · · Liasas (4).

A61K 38/52 · · · Isomerasas (5).

A61K 38/53 · · · Ligasas (6).

A61K 38/54 · · · Mezclas de enzimas o proenzimas cubiertas por más de uno solo de los grupos A61K 38/44 - A61K 38/46 ó A61K 38/51 - A61K 38/53.

A61K 38/55 · · Inhibidores de proteasas.

A61K 38/56 · · · que provienen de plantas.

A61K 38/57 · · · que provienen de animales; que provienen de humanos.

A61K 38/58 · · · · que provienen de sanguijuelas, p. ej.: hirudina, eglina.

CIP2021: Invenciones publicadas en esta sección.

NANOPARTÍCULAS MULTIFUNCIONALES PARA TERAGNOSIS.

(30/07/2020). Solicitante/s: UNIVERSIDAD DE GRANADA. Inventor/es: MARCHAL CORRALES,JUAN ANTONIO, DÍAZ MOCHÓN,Juan José, RUIZ BLAS,María Paz, SÁNCHEZ MARTÍN,Rosario María, CANO CORTÉS,Victoria, NAVARRO MARCHAL,Saúl Abenhamar.

Nanopartículas multifuncionales para teragnosis. La presente invención se refiere al campo de la medicina, en particular a nanopartículas (NP) funcionalizadas para ser utilizadas en la terapéutica (tratamiento o diagnóstico) de cáncer, a composiciones farmacéuticas o nanodispositivos que las comprenden y también al método para obtener dichas nanopartículas funcionalizadas. Las nanopartículas descritas en la presente invención se pueden usar específicamente para tratar el cáncer de una manera eficiente ya que son capaces de detectar selectivamente las células tumorales.

PDF original: ES-2776598_A1.pdf

Formulaciones estables que contienen anticuerpos anti-PCSK9.

(15/07/2020) Una formulación estable que comprende un anticuerpo monoclonal que se une específicamente a PCSK9, en donde PCSK9 comprende los aminoácidos de la SEQ ID NO: 1, el anticuerpo monoclonal en una cantidad de 100 mg/ml a 150 mg/ml y un tampón farmacéuticamente aceptable en una cantidad de 0,05 mM a 40 mM, en donde el tampón farmacéuticamente aceptable es un tampón de acetato de sodio y un tensioactivo farmacéuticamente aceptable en una cantidad que es del 0,004 % p/v al 0,01 % p/v, en donde el tensioactivo farmacéuticamente aceptable es polisorbato 80, polisorbato 60, polisorbato 40 o polisorbato 20 y al menos un estabilizante farmacéuticamente aceptable del 0,5…

Polipéptidos de unión a IL-17A.

(15/07/2020) Polipéptido de unión a IL-17A, que comprende un motivo de unión BM a IL-17A, cuyo motivo consiste en una secuencia de aminoácidos seleccionada entre: i) EX2DX4AX6X7EIX10X11LPNL X16X17X18QX20X21AFIX25 X26LX28X29 en la que, independientemente uno de otro, X2 es A; X4 se selecciona de D y Q; X6 es A; X7 es V; X10 es A; X11 se selecciona de A, D y S; X16 se selecciona de N y T; X17 es W; X18 se selecciona de A y D; X20 es W; X21 se selecciona de F e Y; X25 se selecciona de Q y S; X26 se selecciona entre K y S; X28 es R; y X29 es D; en la que la secuencia i) corresponde a la secuencia desde la posición 8 a la posición 36 en una secuencia seleccionada del grupo que consiste en la SEQ ID NO: 1-1216; y ii) una secuencia de aminoácidos que tiene…

Modificación de FVIII dirigida al sitio.

(15/07/2020). Solicitante/s: BAYER HEALTHCARE LLC. Inventor/es: MURPHY, JOHN, E., CHEN,JIANMIN, PAN,CLARK Q, BARNETT,THOMAS, MEI,BAISONG, STRAUSS,JONATHAN S, TJANDRA,HENDRI, TANG,LIANG, WANG,DEQIAN.

Un conjugado que tiene actividad procoagulante del factor VIII que comprende un factor VIII polipeptídico funcional con el dominio B eliminado que está mutado de manera que el resto de lisina en la posición de aminoácido 1804 se sustituye por un resto de cisteína de manera que exista un resto de cisteína mutante, en el que el factor VIII polipeptídico con el dominio B eliminado está unido covalentemente a un polímero biocompatible en el resto de cisteína mutante en la posición de aminoácido 1804.

PDF original: ES-2821832_T3.pdf

Anticuerpos del OPGL.

(15/07/2020). Solicitante/s: AMGEN FREMONT INC.. Inventor/es: BOYLE, WILLIAM, J., MARTIN,FRANCIS,H, CORVALAN,JOSE,R, DAVIS,GEOFFREY,C.

Un anticuerpo, que comprende una cadena pesada y una cadena ligera, donde: a) la cadena pesada comprende: 1) una secuencia de aminoácidos recogida en SEQ ID NO: 2; o 2) una secuencia de aminoácidos recogida en SEQ ID NO: 13; y b) la cadena ligera comprende: 1) una secuencia de aminoácidos recogida en SEQ ID NO: 4; o 2) una secuencia de aminoácidos recogida en SEQ ID NO: 14; y donde el anticuerpo se une a un ligando de osteoprotegerina (OPGL) e inhibe la unión del OPGL a un receptor de diferenciación y activación de osteoclasto (ODAR).

PDF original: ES-2342820_T3.pdf

PDF original: ES-2342820_T5.pdf

Composición a base de hidroxiapatita en polvo para el tratamiento del linfoma B o T.

(01/07/2020). Solicitante/s: URODELIA. Inventor/es: FRAYSSINET, PATRICK, ROUQUET,NICOLE.

Composición para uso como autovacuna antitumoral para el tratamiento de linfomas B o T en un sujeto, que comprende un polvo de hidroxiapatita y/o de fosfato tricálcico sobre el que se absorben proteínas citoplasmáticas de una muestra de tumor del sujeto, dicho polvo que tiene una superficie específica SS ≥ 30 m2/g y un tamaño de partícula G ≤ 200 μm.

PDF original: ES-2820538_T3.pdf

Tratamiento de disfunción eréctil y otras indicaciones.

(01/07/2020). Solicitante/s: STRATEGIC SCIENCE & TECHNOLOGIES, LLC. Inventor/es: FOSSEL,ERIC THOR.

Una composición para su uso en un método de tratamiento de la disfunción sexual en un sujeto, preferiblemente un sujeto humano, comprendiendo la composición: una sal iónica a una concentración de al menos aproximadamente un 5 % en peso de la composición; goma xantana; propilenglicol; polisorbato 20; sildenafilo y/o una sal del mismo; y un donador de óxido nítrico que comprende L-arginina, una sal de L-arginina y/o HCl de L-arginina, en la que el método comprende aplicar de forma tópica la composición a los genitales.

PDF original: ES-2811515_T3.pdf

Regulador de la secreción hormonal, composición que lo contiene y procedimiento para controlar la secreción hormonal mediante su uso.

(17/06/2020). Solicitante/s: Gemvax & Kael Co., Ltd. Inventor/es: KIM,SANG JAE.

Un modulador de la secreción hormonal que comprende un péptido que incluye una secuencia de aminoácidos de SEQ ID NO: 1, una secuencia de aminoácidos que tiene una identidad de secuencia de al menos 80 % con la SEQ ID NO: 1, o un fragmento de la secuencia de aminoácidos para su uso en un procedimiento de tratamiento, alivio o prevención de enfermedades o síntomas relacionados con los niveles de hormonas sexuales que inducen síntomas de enfermedades o niveles de hormonas sexuales que afectan a las enfermedades o la progresión de las enfermedades, en el que las enfermedades se seleccionan del grupo que consiste en cáncer de mama, cáncer de ovario, menorragia, endometriosis, adenomiosis, miomas uterinos, infertilidad femenina o masculina, pubertad precoz en niños y una combinación de las mismas, en el que el péptido actúa como un agonista de la hormona liberadora de la gonadotropina (GnRH).

PDF original: ES-2808076_T3.pdf

Antagonistas peptídicos de la familia calcitonina CGRP de hormonas peptídicas y su uso.

(17/06/2020) Un antagonista del péptido relacionado con el gen de la calcitonina, o una sal farmacéuticamente aceptable del mismo, teniendo dicho antagonista la estructura de Fórmula I: X1-Y1-Z1 (I) en donde: X1 es X11-X12-X13-X14-X15-X16-X17 (SEQ ID NO: 16), en donde X11 se selecciona del grupo que consiste en Ala, Cys y Gly, y X12 se selecciona del grupo que consiste en Cys y Ser, siempre que uno de X11 y X12 sea Cys, X13 se selecciona del grupo que consiste en Arg, Asn, Asp y Val, X14 se selecciona del grupo que consiste en Leu, Phe y Thr, X15 se selecciona del grupo que consiste en Ala, Gly y Ser, X16 se selecciona del grupo que consiste en Ala, Ile, Leu, Ser y Val, y X17 es Cys; y Y1 se selecciona del grupo que consiste en -Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro- Arg-Thr-Asn-(SEQ…

Péptido derivado de GPC3, composición farmacéutica para el tratamiento o la prevención de cáncer usando el mismo, inductor de inmunidad y método para producir células presentadoras de antígeno.

(17/06/2020). Solicitante/s: CYTLIMIC INC. Inventor/es: OKA, MASAAKI, TAMADA,KOJI, MIYAKAWA,TOMOYA, HAZAMA,SHOICHI, UDAKA,KEIKO.

Composición farmacéutica para su uso en el tratamiento o la prevención de cáncer, que comprende un péptido que consiste en una secuencia de aminoácidos de una cualquiera de las SEQ ID NO: 1, 2, 4, 5 y 7 a 11, en la que el péptido es capaz de unirse a una pluralidad de alelotipos del gen A de HLA-A.

PDF original: ES-2805829_T3.pdf

Moléculas de armazón a base de fibronectina de unión a glipicano-3.

(17/06/2020). Solicitante/s: BRISTOL-MYERS SQUIBB COMPANY. Inventor/es: LIPOVSEK,DASA, RAKESTRAW,GINGER C, KRYSTEK,STANLEY RICHARD JR, CHEN,GUODONG, BARNHART,BRYAN C, TERRAGNI,CHRISTINA, TOTH,JOSEPH, CARVAJAL,IRVITH M, O'NEIL,STEVEN R, HUANG,RICHARD Y, LOFFREDO,JOHN THOMAS.

Un polipéptido que comprende un décimo dominio de fibronectina humana de tipo III (10Fn3) que comprende los bucles BC, DE y FG, en donde el polipéptido se une específicamente al glipicano-3 humano (GPC3) con una KD de 1 μM o menos, y en donde (a) los bucles BC, DE y FG comprenden las SEQ ID NO: 6, 7 y 8, respectivamente; (b) los bucles BC, DE y FG comprenden las SEQ ID NO: 19, 20 y 21, respectivamente; (c) los bucles BC, DE y FG comprenden las SEQ ID NO: 32, 33 y 34, respectivamente; (d) los bucles BC, DE y FG comprenden las SEQ ID NO: 45, 46 y 47, respectivamente; (e) los bucles BC, DE y FG comprenden las SEQ ID NO: 58, 59 y 60, respectivamente; (f) los bucles BC, DE y FG comprenden las SEQ ID NO: 71, 72 y 73, respectivamente; (g) los bucles BC, DE y FG comprenden las SEQ ID NO: 84, 85 y 86, respectivamente; o (h) los bucles BC, DE y FG comprenden las SEQ ID NO: 99, 100 y 101, respectivamente.

PDF original: ES-2809125_T3.pdf

Macrociclos peptídicos frente a Acinetobacter baumannii.

(17/06/2020) Un compuesto de fórmula (I) **(Ver fórmula)** en la que: X1 es C-L1-R11 o N, X2 es C-L2-R12 o N, X3 es C-L3-R13 o N, X4 es C-L4-R14 o N, con la condición de que no más de tres de X1, X2, X3 y X4 sean N; X5 es C-L5-R15 o N, X6 es C-L6-R16 o N, X7 es C-L7 R17 o N, X8 es C-L8-R18 o N, con la condición de que no más de tres de X5, X6, X7 y X8 sean N; R1 es -(CH2)m-heteroarilo o -(CH2)m-heterocicloalquilo, en el que el heteroarilo está opcionalmente sustituido con uno o más halo, ciano, alquilo C1-7, haloalquilo C1-7, cicloalquilo C3-7 o alcoxi C1-7; R2, R4 y R6 se seleccionan cada uno individualmente de hidrógeno, alquilo C1-7, haloalquilo C1-7 y cicloalquilo C3-7; R3 es -alquilo…

Método para activar células T auxiliares.

(10/06/2020) Una composición para su uso en el tratamiento o prevención del cáncer mediante la activación de células T auxiliares en un sujeto, en donde dicha composición comprende un péptido WT1, un polinucleótido que codifica el péptido WT1, un vector de expresión que contiene el polinucleótido o células que contienen el vector de expresión, en donde las células T auxiliares reconocen un complejo del péptido WT1 y una molécula del MHC de clase II seleccionada entre una molécula HLA-DRB1*08:02, una molécula HLA-DRB1*13:02, una molécula HLADRB1* 14:03, una molécula HLA-DRB1*14:05, una molécula HLA-DQB1*03:02 y una molécula HLA-DQB1*04:01, en donde el péptido WT1 es: (a) un péptido…

Variantes de IL-2 modificadas que activan selectivamente las células T reguladoras para el tratamiento de enfermedades autoinmunes.

(20/05/2020). Solicitante/s: Delinia, Inc. Inventor/es: GREVE, JEFFREY.

Una composición farmacéutica formulada para administración parenteral, que comprende una proteína variante de IL-2 que tiene por lo menos un 95% de identidad de secuencia con la SEQ ID NO: 1, y que contiene la sustitución D109C con respecto a la SEQ ID NO: 1.

PDF original: ES-2807260_T3.pdf

Sal sólida de glutatión oxidado y método para producirla.

(13/05/2020). Solicitante/s: KANEKA CORPORATION. Inventor/es: KINOSHITA, KOICHI, MOROSHIMA, TADASHI, TAOKA, NAOAKI, MOURI,TAKU.

Sal sólida de glutatión oxidado, que comprende glutatión oxidado y al menos un catión seleccionado de un catión amonio, un catión de calcio y un catión de magnesio; en la que la sal sólida de glutatión oxidado está en un estado sólido a temperatura ambiente; y en la que la sal sólida de glutatión oxidado se selecciona del grupo que consiste en una sal de monoamonio de glutatión oxidado, una sal de hemicalcio o una sal de monocalcio de glutatión oxidado, y una sal de hemimagnesio o una sal de monomagnesio de glutatión oxidado.

PDF original: ES-2795672_T3.pdf

Moléculas de fusión anticuerpos-mutante de interferón modificadas.

(06/05/2020). Solicitante/s: ImmunGene, Inc. Inventor/es: GREWAL, IQBAL, KHARE,SANJAY D, GRESSER,MICHAEL, SYED,RASHID.

Una molécula de fusión genéticamente modificada que comprende un anticuerpo antígeno asociado a tumor (AAT) (Ab) unido a una molécula mutante de interferón alfa (IFN-α), la molécula mutante de IFN-α que consiste en la secuencia de aminoácidos establecida en SEQ ID NO: 13 en donde R149 es A y en donde R162 es A, y en donde dicho anticuerpo está unido directamente a dicha molécula mutante de IFN-α, en donde dicha molécula de fusión cuando se pone en contacto con una célula tumoral da como resultado la muerte o inhibición del crecimiento o proliferación de dicha célula tumoral.

PDF original: ES-2800426_T3.pdf

Lipopéptidos de alta pureza, micelas de lipopéptidos y procesos para preparar los mismos.

(06/05/2020). Solicitante/s: Cubist Pharmaceuticals LLC. Inventor/es: ZENONI, MAURIZIO, TAGLIANI, AURO R., KELLEHER,THOMAS J, LAI,JAN-JI, DECOURCEY,JOSEPH P.

Un método para purificar daptomicina a partir de moléculas o agregados de alto peso molecular, en donde la daptomicina se proporciona en forma micelar, dicho método comprendiendo: a. someter la daptomicina micelar a condiciones en las que la daptomicina está en forma monomérica alterando el pH; y b. separar las moléculas de daptomicina monomérica de moléculas o agregados de alto peso molecular mediante una técnica de separación por tamaño.

PDF original: ES-2799706_T3.pdf

Inmunotoxinas de unión a CD20 para inducir la internalización celular y procedimientos que usan las mismas.

(06/05/2020) Una proteína de unión a CD20 que comprende: a) una región de unión a CD20 que comprende una región de unión de tipo inmunoglobulina: (i) capaz de unirse específicamente a una parte extracelular de la molécula CD20; y (ii) que comprende uno o más de: fragmento de anticuerpo de dominio único, fragmento variable monocatenario, fragmento variable de anticuerpo, fragmento de unión a antígeno, y fragmento Fd; y b) un polipéptido efector de toxina Shiga; en la que el polipéptido efector de toxina Shiga comprende: una secuencia de aminoácidos que es al menos un 85 % idéntica a la secuencia de aminoácidos mostrada en la SEQ ID NO: 1 o la SEQ ID NO: 25; o una secuencia de aminoácidos…

Método de producción de lactoferrina.

(06/05/2020) Método de producción de lactoferrina que comprende al menos las etapas de: a) desechar la materia prima que no ha sido tratada a una temperatura superior a 50 ºC y seleccionada del grupo que consiste en leche desnatada, leche libre de caseinato, suero de queso y calostro desnatado; b) someter esta materia prima a una etapa de extracción en una resina de intercambio catiónico usando una concentración de cloruro de sodio de un soluto excluido para obtener una solución de lactenina (LN) o proteína básica de la leche (MBP); c) someter esta solución de LN o MBP a una etapa de purificación en una resina de intercambio catiónico equilibrada con una solución reguladora de acetato a un pH entre 4 y 9 y eluída con una solución reguladora de cloruro de…

Agentes PD-1 de alta afinidad y procedimientos de uso.

(06/05/2020). Solicitante/s: THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY. Inventor/es: WEISSMAN, IRVING L., KRUSE,ANDREW, RING,AARON MICHAEL, MANGLIK,AASHISH, MAUTE,ROY LOUIS, MCCRACKEN,MELISSA N, GORDON,SYDNEY.

Un polipéptido de muerte celular programada de alta afinidad 1 (PD-1), donde el polipéptido es una variante de la secuencia de PD-1 natural humano que comprende una secuencia de aminoácidos como se establece en SEQ ID NO: 2 o una secuencia de al menos 85 % de identidad con el mismo, donde el polipéptido PD-1 de alta afinidad: (a) carece de un dominio transmembrana PD-1, y (b) comprende una o más sustituciones de aminoácidos, donde la una o más sustituciones de aminoácidos aumenta la afinidad del polipéptido PD-1 de alta afinidad por el ligando 1 de muerte celular programada 1 (PD-L1) en comparación con la afinidad por PD- L1 del polipéptido PD-1 natural humano, y donde la una o más sustituciones de aminoácidos se encuentra en una posición de aminoácidos seleccionada de entre: V39, L40, N41, Y43, R44, M45, S48, N49, Q50, T51, D52, K53, A56, Q63, G65, Q66, V72, H82, M83, R90, Y96, L97, A100, S102, L103, A104, P105, K106, y A107 de SEQ ID NO: 2.

PDF original: ES-2819451_T3.pdf

Proceso para la purificación de daptomicina.

(06/05/2020). Solicitante/s: Cubist Pharmaceuticals LLC. Inventor/es: KELLEHER,THOMAS J, LAI,JAN-JI, DECOURCEY,JOSEPH P, ZENONI, MAURIZIO, TAGLIANI, AURO R.

Un método para purificar daptomicina que comprende: a) someter a la daptomicina a condiciones en las que una solución micelar de daptomicina se forma alterando el pH; y b) separar las micelas de daptomicina en la solución micelar de daptomicina de los contaminantes de bajo peso molecular mediante una técnica de separación por tamaño.

PDF original: ES-2799702_T3.pdf

Inhibidores de Mcl-1 para su uso en el tratamiento de enfermedades provocadas por neovascularización patológica.

(06/05/2020). Solicitante/s: THE WALTER AND ELIZA HALL INSTITUTE OF MEDICAL RESEARCH. Inventor/es: COULTAS,LEIGH, DEWSON,GRANT, WATSON,EMMA.

Un agente que suprime la expresión de Mcl-1 o la actividad del polipéptido Mcl-1 para su uso en el tratamiento de una enfermedad o afección del ojo asociada con la neovascularización patológica, en donde la enfermedad o afección se selecciona del grupo que consiste en retinopatía diabética, neovascularización patológica coroidea o retiniana, degeneración macular senil, retinopatía de la prematuridad, traumatismo ocular o isquemia, edema o neovascularización inducida por intervención quirúrgica, oclusión de la vena retiniana, enfermedad de Coats, retinopatía de células falciformes y glaucoma neovascular.

PDF original: ES-2803581_T3.pdf

Métodos y composiciones para el tratamiento de enfermedades autoinmunes e inflamatorias.

(29/04/2020) Un anticuerpo anti-RhoB o fragmento del mismo para uso en la inhibición de una enfermedad inflamatoria o autoinmune en un sujeto que lo necesita, en el que dicho anticuerpo anti-RhoB o fragmento del mismo comprende los seis dominios CDR del anticuerpo anti-RhoB 7F7 o el anticuerpo anti-RhoB 9G5, en el que dicho anticuerpo anti-RhoB 7F7 es un anticuerpo monoclonal que comprende las SEQ ID NOs: 10 y 12, y dicho anti-RhoB 9G5 es un anticuerpo monoclonal que comprende las SEQ ID NOs: 14 y 16, y en el que la cadena ligera del anticuerpo anti-RhoB 7F7 comprende: - CDR1 que tiene la secuencia de aminoácidos RSSQSLVHSNGNTYLH, - CDR2 que tiene la secuencia de aminoácidos KVSNRFS, y - CDR3 que tiene la secuencia de aminoácidos SQSTHVPYTFGGGTKLEIK; y la cadena pesada del…

Proteínas de fusión para la inhibición de angiogénesis.

(29/04/2020) Una proteína de fusión que comprende: un péptido de unión a integrina que comprende unión de desintegrina a integrina αvβx o α5β1 o sus fragmentos de unión a integrina; otro péptido de unión a proteínas que se une a un factor angiogénico, en el que el factor angiogénico comprende angiopoyetina (ANG), efrina (Eph), factor de crecimiento de fibroblastos (FGF), neuropilina (NRP), activadores de plasminógeno, receptor activador de plasminógeno de tipo uroquinasa (uPAR), factor de crecimiento derivado de plaquetas (PDGF), factor de crecimiento tumoral beta (TGF-β), factor de crecimiento endotelial vascular (VEGF), cadherina endotelial vascular (VE-cadherina), Factor de crecimiento similar a la insulina (IGF), factor de crecimiento…

Métodos y composiciones para tratar afecciones cutáneas asociadas a hiperreactividad vascular.

(29/04/2020) Una composición tópica para su uso en un método de tratamiento de un paciente que tenga una afección cutánea caracterizada por hiperreactividad vascular cutánea, en donde la composición tópica se aplica en el área o las áreas de la piel del paciente afectadas con dicha hiperreactividad vascular, y en donde la composición tópica comprende una cantidad de una neurotoxina botulínica eficaz para reducir la vasodilatación en la microvasculatura cutánea, en donde dicha neurotoxina botulínica se asocia no covalentemente a un transportador peptídico con carga positiva seleccionado entre Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-(Lys)n-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg (SEQ ID NO: 3); Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-(Lys)n-Gly-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg (SEQ ID NO: 4), donde n es un número entero de 5 a 20; y Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-(Lys)-Gly-Arg-…

Inmunoterapia novedosa contra varios tumores de la sangre, en particular contra la leucemia linfoide crónica (LLC).

(29/04/2020). Solicitante/s: IMMATICS BIOTECHNOLOGIES GMBH. Inventor/es: RAMMENSEE, HANS, GEORG, STEVANOVIC, STEFAN, KOWALEWSKI,DANIEL, STICKEL,JULIANE.

Péptido de entre 10 y 30 aminoácidos de longitud, el cual comprende una secuencia de aminoácidos consistente en la SEQ ID N.º 167, o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2802155_T3.pdf

Compuestos y métodos para tratar la inflamación.

(29/04/2020). Solicitante/s: Tufts Medical Center, Inc. Inventor/es: KUMAR,KRISHNA, COHEN,CHARLES, KOPIN,ALAN S, HARWOOD,BENJAMIN N, RAMAN,VENKATA S, HAMRAH,PEDRAM.

Una composición para uso en un método para tratar la inflamación ocular en un sujeto que lo necesita, comprendiendo el método administrar al sujeto una cantidad terapéuticamente efectiva de la composición, en la que la composición comprende: un fragmento de quemerina que tiene la secuencia de YFPGQFAFS (SEQ ID NO.: 2) o un análogo de quemerina que tiene la secuencia de Y*FLPS*QFA*-Tic-S (SEQ ID NO.: 3), * que denota aminoácidos D, en donde Tic representa el ácido 1,2,3,4-tetrahidroisoquinolin-3-carboxílico; una entidad lipídica enlazada al fragmento de quemerina o análogo de quemerina; y opcionalmente un enlazante que conecta la entidad lipídica al fragmento de quemerina o análogo de quemerina.

PDF original: ES-2805037_T3.pdf

Marcador molecular para células madre cancerosas.

(29/04/2020). Solicitante/s: Sapporo Medical University. Inventor/es: TORIGOE,TOSHIHIKO, HIROHASHI,YOSHIHIKO, SATOH,NORIYUKI, KAMIGUCHI,KENJIRO, MORITA,RENA, NISHIZAWA,SATOSHI, TAKAYA,AKARI.

Un péptido seleccionado del grupo que consiste en: DNAJB8 : AFMEAFSSF (SEQ ID NO: 71); DNAJB8 : AYRKLALRW (SEQ ID NO: 68); y DNAJB8 : IFREFFGGL (SEQ ID NO: 70).

PDF original: ES-2805553_T3.pdf

COMPOSICIÓN PARA LA ESTIMULACIÓN DEL SISTEMA INMUNE EN PECES QUE CONTIENE PÉPTIDOS RECOMBINANTES, PÉPTIDOS RECOMBINANTES INMUNOESTIMULANTES Y SECUENCIAS NUCLEOTÍDICAS QUE LOS CODIFICAN.

(23/04/2020). Solicitante/s: UNIVERSIDAD DE CONCEPCION. Inventor/es: ACOSTA ALBA,JANNEL, TOLEDO ALONSO,Jorge, GONZALEZ CHAVARRIA,Ivan, FERNANDEZ ELGUETA,Katherina, MUÑOZ FLORES,Carolina, KAPPES REVECO,Tomas, SANDOVAL SANDOVAL,Felipe, VALENZUELA SALDIAS,Ariel.

La presente invención se refiere a una composición, una micropartícula y una formulación alimenticia que comprende péptidos recombinantes que estimulan el sistema inmune e incrementa la respuesta antibacteriana sistémica en peces, las secuencias aminoacídicas de dichos péptidos recombinantes, y las secuencias nucleotídicas que los codifican. La presente invención refuerza el propio sistema inmune de los peces, permite prevenir la infección de un amplio espectro de patógenos (virus y bacterias), y además no produce daños medioambientales colaterales.

Biomarcadores de TB.

(22/04/2020) Un método para el diagnóstico de TB en un sujeto, comprendiendo el método: (a) proporcionar una muestra de dicho sujeto, siendo dicha muestra seleccionada del grupo que consiste en: sangre, suero y plasma; (b) determinar la concentración en dicha muestra de los siguientes biomarcadores: IL-1ra, IL6, IL-7, IL-8, IL- 12p70, FGF-básico, IP-10 y VEGF; (c) convertir cada concentración de biomarcador determinada en (b) en un valor de decil; y (d) convertir cada valor de decil en una presencia o ausencia binaria comparando los valores de decil de (c) con los siguientes valores de corte de cuantil específico: **(Ver fórmula)** en donde un valor de decil que se corresponde con o supera el valor de corte de cuantil específico se convierte en la presencia binaria del biomarcador, y un valor de decil inferior al…

Interferón porcino pegilado y métodos de utilización del mismo.

(22/04/2020). Solicitante/s: Elanco US Inc. Inventor/es: CANNING, PETER CONNOR, SKIDMORE,LILLIAN, KNUDSEN,NICKOLAS.

Una variante de interferón-α porcino (pINF-α) que comprende: XaXbCDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGS AAAWNESLLHQFYTGLDQQLRDLEACVMQEAGLEGTPLLEEDSIRAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMR SFSSSRNLQDRLRKKE (SEQ ID NO: 1), en donde el residuo E103, E107, L112, Y136 o Q102 (numeración con respecto a SEQ ID NO: 4) está sustituido con un aminoácido sintético; y en donde XaXb es carencia de aminoácidos, una prolina únicamente, o prolina-serina.

PDF original: ES-2793773_T3.pdf

1 · · 4 · 7 · 14 · 27 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .