271 Inventos, patentes y modelos industriales publicados el Miércoles 22 de Julio de 2015.

Nuevos compuestos de flavonol, una fracción/extracto bioactivo de Ulmus wallichiana y sus compuestos para la prevención o tratamiento de trastornos relacionados con la salud de los huesos.

(22/07/2015) Un compuesto de flavonol de fórmula general 1 en la que R1 es OH y R2 es OH o H.**Fórmula**

Polipéptidos, dominios variables de anticuerpo y antagonistas.

(22/07/2015) Un dominio variable único de inmunoglobulina anti-receptor TNFα tipo 1 que comprende la siguiente secuencia de aminoácidos: EVQLLESGGGLVQPGGSLRLSCAASGFTFAHETMVWVRQAPGKGLEWV SHIPPDGQDPFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCAL LPKRGPWFDYWGQGTLVTVSS

Dispersión de poliuretano para la laminación de láminas compuestas.

(22/07/2015) Dispersión acuosa que contiene un poliuretano, compuesto de a) diisocianatos orgánicos b) compuestos dihidroxi con un peso molecular de 500 a 5000 g/mol, que no contienen ningún grupo iónico o grupo que pueda convertirse en un grupo iónico c) alcoholes mono a trihidroxilados, que contienen adicionalmente un grupo iónico d) dado el caso, otros compuestos distintos de a) a c), caracterizada porque el poliuretano contiene menos del 0,6 % en peso de grupos urea (calculado con un peso molecular de 56 g/mol), el grupo iónico de c) está neutralizado al menos parcialmente con un catión alcalino y la conversión de los compuestos a), b), c) y d) no se realiza en presencia…

Combinaciones de un agente de control biológico e insecticidas.

(22/07/2015) Una composición que comprende una espora de Bacillus firmus CNCM I-1582 y un agente de control de insectos, en la que el agente de control de insectos se selecciona de la lista: clotianidina, imidacloprid, tiacloprid, tiametoxam, acetamiprid, metiocarb, tiodicarb, beta-ciflutrina, ciflutrina, deltametrina, teflutrina, emamectina-benzoato, avermectina, spirodiclofen, spiromesifen, spirotetramat, flubendiamida, clorantraniliprol, o Ciantraniliprol 4-{[(6- cloropirid-3-il)metil](2,2-difluoretil)amino} furan-2(5H)-ona conocido a partir del documento WO 2007/115644).

Máquina eléctrica con apilamiento de laminaciones de doble cara.

(22/07/2015) Una máquina eléctrica síncrona que comprende: un generador de imanes permanentes de accionamiento directo; al menos un rotor con un núcleo de rotor interno que comprende imanes permanentes interiores y un núcleo de rotor exterior que comprende imanes permanentes exteriores , en el que el núcleo de rotor exterior se invierte con respecto al núcleo del rotor interior ; y al menos un estator de doble cara con una cara del estator interior y una cara del estator exterior que comprende un apilamiento de laminaciones de doble cara configurado para habilitar al flujo magnético para que fluya radialmente entre la cara del estator interior y la cara del estator exterior, habilitando…

Conexión de disco de freno y cubo.

(22/07/2015) Conexión de disco de freno y cubo, en la que un disco de freno presenta en su periferia interior una pluralidad de elementos de apoyo distribuidos de una manera uniforme, que se corresponden con elementos de arrastre dispuestos en la periferia exterior de un cubo en el sentido de un seguro contra giro, en la que para la transmisión de un momento de freno, en espacios intermedios formados entre los elementos de arrastre y los elementos de apoyo están dispuestos unos elementos intermedios insertados en la dirección axial del disco de freno con dos brazos que se apoyan entre sí, en cuyas superficies alejadas una de la otra se apoyan un elemento de arrastre asociado o bien un elemento de apoyo asociado,…

Chapa de empalme y método asociado para unir secciones de fuselaje.

(22/07/2015) Una chapa de empalme para unir secciones de fuselaje , comprendiendo la chapa de empalme: una correa configurada para servir de puente a las secciones de fuselaje; una barra de cizalladura que recubre la correa ; y un herraje que tiene secciones primera y segunda longitudinalmente extendidas que se extienden más allá de los lados opuestos de la correa, estando configurada cada sección longitudinalmente extendida para recubrir al menos dos larguerillos de una sección de fuselaje respectiva, la chapa de empalme se caracteriza por que: el herraje se coloca entre la correa y la barra de cizalladura de tal manera que la correa y la barra de cizalladura estén separadas.

Base transportadora unitaria y conformadora y un formador de bastidor deslizante para formar un contenedor transportable.

(22/07/2015) Un método de producir un contenedor transportable para las mercancías a granel que comprende los pasos de: Colocar una bolsa con una parte superior abierta y una base cerrada a través de una abertura formadora definida por un formador de bastidor deslizante que tiene por lo menos una de las paredes , el formador de bastidor deslizante rodeando una parte de la bolsa con la base cerrada estando colocada adyacente a un soporte de fondo y estando la parte superior abierta separada verticalmente de la base cerrada y colocada adyacente a una fuente de alimentación ; Llenar la bolsa con las mercancías a granel desde la fuente de alimentación a través de la parte superior abierta ; Situar una envoltura retráctil…

Procedimiento para la reacción endotérmica en fase gaseosa en un reactor.

(22/07/2015) Procedimiento para la conversión química del tetracloruro de silicio con hidrógeno en el triclorosilano en un reactor, en el que unos eductos gaseosos se introducen en el reactor a través de un dispositivo de entrada de gases y éstos son distribuidos uniformemente, mediante un dispositivo de distribución de gases, en una zona de calefacción, en la que los eductos gaseosos son calentados mediante unos elementos de calefacción a una temperatura media de 500-1.500°C, y a continuación son conducidos a una zona de reacción, regulándose el calentamiento de los elementos de calefacción mediante unas mediciones de la temperatura en la zona de reacción, estando presentes para esta finalidad en la zona de reacción por lo menos dos sensores de la temperatura,…

Un método para cosechar algas.

(22/07/2015) Un método para recolectar algas de una solución acuosa que contiene algas, que comprende las etapas de (i) primero, proporcionar un coagulante orgánico a dicha solución y mezclar dicha solución, y (ii) posteriormente, proporcionar un material de arcilla inorgánica a dicha solución después de la etapa (i) y mezclar dicha solución para formar algas coaguladas, y (iii) agitar la solución resultante después de la etapa (ii) para formar algas floculadas, y (iv) posteriormente, separar y recolectar las algas floculadas de dicha solución.

Placa de cocina con aspiración central hacia abajo de los vapores de cocina.

(22/07/2015) Placa de cocina con una o más hornillas que, en una vista en planta, solamente en la región alrededor de su baricentro de superficie geométrico presenta una o más escotaduras , y con uno o más dispositivos para la aspiración y evacuación de vapores de cocina, en donde estos dispositivos para la aspiración y evacuación de vapores de cocina que se han producido y se producen sobre la o las hornillas aspiran los vapores en una dirección orientada verticalmente hacia abajo, y con un dispositivo provisto en el lado inferior de la placa de cocina y que forma una unidad de montaje con la placa de cocina para el funcionamiento de la placa de cocina y para la aspiración y evacuación de los vapores de cocina hacia abajo, caracterizada por que este dispositivo…

Métodos y kits para análisis de metilación en trastornos proliferativos celulares colorrectales.

(22/07/2015) Un método para la detección de carcinoma colorrectal en un sujeto, que comprende determinar el nivel de expresión de RASSF2 en una muestra biológica seleccionada del grupo que consiste en plasma sanguíneo, suero sanguíneo, sangre completa, y células sanguíneas, aislada de dicho sujeto, en donde dicho nivel de expresión se determina por medio de la detección de la presencia o ausencia de metilación de CpG dentro de dicho gen, en donde la presencia de metilación indica la presencia de carcinoma colorrectal.

Compuestos insecticidas a base de 4-amino-tieno[2,3-d]-pirimidina y procedimientos para su uso.

(22/07/2015) Un compuesto 4-amino-tieno[2,3-d]-pirimidina para combatir o controlar insectos, arácnidos o nematodos de fórmula I:**Fórmula** donde X se selecciona a partir de halógeno, alquilo C1-C10 o haloalquilo C1-C10; R1 se selecciona a partir del grupo compuesto por hidrógeno, halógeno, formilo, alquilo C1-C10, alquenilo C1- C10, alquinilo C1-C10, haloalquilo C1-C10, haloalquenilo C1-C10, haloalquinilo C1-C10, alcoxi C1-C10, alcoxi C1- C6-alquilo C1-C6, haloalcoxi C1-C10, alquiltio C1-C10, haloalquiltio C1-C10, alquilsulfinilo C1-C10, haloalquilsulfinilo C1-C10, alquilsulfonilo C1-C10, haloalquilsulfonilo C1-C10, alquilamino C1-C10, haloalquilamino C1-C10, di(alquil C1-C10)amino, di(C1-C10)-haloalquilamino, CN, -CR3≥NOH, -CR3≥NOCH3 y -CR3≥NOC2H5; R2 se selecciona a partir del grupo compuesto por hidrógeno,…

Un cartucho aplicador de veteado y un sistema para unir el mismo a un aparato de veteado.

(22/07/2015) Un cartucho para albergar y dispensar aplicadores de veteado para un aparato de veteado automático que tiene un soporte de cartucho, de tal manera que el cartucho incluye: - una caja con un extremo de dispensación, un eje longitudinal y una ranura alargada, de tal modo que el extremo de dispensación incluye una posición de dispensación de aplicador en la que un aplicador puede ser al menos parcialmente accesible desde el exterior de la caja; y - un miembro de soporte de aplicadores, confinado dentro de la caja para su movimiento longitudinal en su interior y que es capaz de portar una pila de aplicadores; de tal modo que la ranura alargada es capaz de recibir operativamente un miembro de carga cuando el cartucho se encuentra en el soporte de cartucho, a fin de forzar el miembro de soporte hacia el extremo de dispensación,…

Ácido nucleico antisentido de kanamicina para el tratamiento del cáncer.

(22/07/2015) Un ácido nucleico aislado para su uso en terapia, en el que dicho ácido nucleico aislado comprende una secuencia antisentido complementaria a un fragmento de la secuencia que codifica para la proteína de resistencia a la kanamicina, fragmento que es de al menos 50 nucleótidos de longitud y en el que dicho ácido nucleico aislado es capaz de provocar una respuesta inmunitaria en un mamífero.

Máquina y método para el ensamblaje de productos farmacéuticos y productos similares a farmacéuticos.

(22/07/2015) Un método de ensamblar un producto farmacéutico que tiene al menos tres componentes sólidos de comprimidos formados de manera independiente, estando el método caracterizado por: suministrar uno separado de al menos dichos tres componentes sólidos de comprimidos a partir de uno separado de al menos tres almacenes de componentes, dispensar al menos dichos tres componentes sólidos de comprimidos a partir de al menos dichos tres almacenes de componentes; aplicar un líquido de unión al menos a uno de dichos tres componentes de comprimidos; posicionar al menos dichos tres componentes sólidos de comprimidos que son dispensados desde al menos dichos tres almacenes de componentes; conectar juntos al menos dichos tres componentes sólidos de comprimidos presionando dichos tres componentes sólidos de comprimidos juntos.

Procedimiento para la producción de una mezcla de aislamiento térmico.

(22/07/2015) Procedimiento para la producción continua de una mezcla de aislamiento térmico que comprende partículas de ácido silícico y partículas de agente opacificante, caracterizado por que una corriente pre-mezclada que comprende un gas de soporte, partículas de ácido silícico y partículas de agente opacificante se incorpora en un molino por rebotamiento fino, allí se muele y mezcla y, a continuación, el sólido se separa de la corriente de gas, y en el que el molino por rebotamiento fino es un molino de torbellino de aire que comprende pistas de molienda dispuestas una sobre otra en un eje rotatorio, y en el que las…

Nutrición láctea con cereales.

Sección de la CIP Necesidades corrientes de la vida

(22/07/2015). Solicitante/s: COMPAGNIE GERVAIS-DANONE. Inventor/es: FRANCOIS, ALAN, BOËLE,CHRISTIAN, CAMPARGUE,CHRISTIAN. Clasificación: A23C9/123, A23C9/12, A23C9/13, A23C9/127.

El uso de un producto lácteo fermentado contenido en un envase para mezclar con cereales, en donde el mezclamiento comprende las siguientes etapas: a) proporcionar cereales en un recipiente que tiene una abertura superior, preferiblemente un bol, una taza, un vaso o un plato, b) verter el producto lácteo fermentado desde el envase sobre los cereales, y c) opcionalmente agitar con un medio de agitación, preferiblemente con una cuchara, y en donde el producto lácteo fermentado tiene una viscosidad de 300 a 600 mPa.s, preferiblemente de 400 a 550 mPa.s, medida a 10ºC, a un índice de cizallamiento de 64 s-1, después de 10 segundos a este índice de cizallamiento, con un reómetro de 2 cilindros co-axiales.

PDF original: ES-2549935_T3.pdf

Codo para canalizaciones de fluido.

(22/07/2015) Codo para canalizaciones de fluido con una pared interior curvada y una pared exterior curvada y con al menos un elemento rígido de guía de flujo, en el que el al menos un elemento de guía se extiende paralelamente a la pared interior curvada y la pared exterior curvada , caracterizado por que el codo está constituido por dos tramos parciales ensamblados, estando la pared exterior dividida en dos partes con cantos de corte opuestos y estando la pared interior dividida en dos partes con cantos de corte opuestos y estando el al menos un elemento de guía dividido en dos partes con cantos de borde opuestos .

Instrumentos y sistemas de ablación con balón criogénico.

(22/07/2015) Un instrumento de ablación de tejido criogénico, que comprende: un cuerpo flexible alargado que tiene un puerto de administración proximal adaptado para acoplarse con una fuente de refrigerante fluido presurizado, y un lumen de administración en comunicación fluida con el puerto de administración proximal y que se extiende a través del cuerpo alargado hasta una porción distal del mismo; un miembro de dispersión acoplado a o formado fuera de la porción distal del cuerpo alargado, incluyendo el miembro de dispersión un lumen interior en comunicación fluida con o que comprende de otra manera una porción del lumen de administración; y un balón…

Proteínas de fusión, usos de las mismas y procesos para producir las mismas.

(22/07/2015) Una proteína de fusión que comprende aminoácidos consecutivos que, comenzando en el extremo amino de la proteína, corresponden a aminoácidos consecutivos presentes en (i) un péptido restringido por CMH humano de citomegalovirus, (ii) un primer enlazador peptídico, (iii) una b-2 microglobulina humana, (iv) un segundo enlazador peptídico, (v) una cadena HLA-A2 de una molécula CMH de clase I humana, (vi) un tercer enlazador peptídico, (vii) una región variable de una cadena pesada de un fragmento scFv de un anticuerpo, y (viii) una región variable de una cadena ligera de tal fragmento scFv, en la que los aminoácidos consecutivos que corresponden a (vii)…

Fotoporación microfluídica.

(22/07/2015) Un sistema microfluídico de permeabilización celular para la permeabilización de una o más células en un flujo de fluido, comprendiendo el sistema un canal microfluídico para la canalización de al menos una célula en un flujo de fluido y una fuente óptica que genera un haz de luz para la permeabilización de al menos una célula, en donde canal microfluídico comprende una parte de permeabilización , en la cual, en uso, las células se permeabilizan, que se caracteriza por que el canal y la fuente están dispuestos de manera que, en uso, el haz de luz y el flujo de fluido son colineales en dicha parte de permeabilización del canal .

Material de electrodo positivo para batería recargable y proceso para producir el mismo.

(22/07/2015) Un material de catodo para una bateria recargable que contiene un material activo de catodo representado por la formula general LinFePO4 (en la que n representa un numero de 0 a 1) como un componente principal y molibdeno (Mo), caracterizado porque el contenido de molibdeno (Mo) se encuentra en el intervalo del 0,1 al 5% molar, en terminos de relacion de elementos, basado en hierro en el material activo del catodo.

Aparato de refrigeración, en particular aparato de refrigeración doméstico.

(22/07/2015) Aparato de refrigeración, en particular aparato de refrigeración doméstico con un cuerpo de aparato que define un espacio de refrigeración, con un elemento de soporte , sobre el que está fijado un compresor conectado en el circuito de refrigerante, y con al menos una bandeja de condensación para la acumulación de agua de rocío que se forma en el espacio de refrigeración, en el que el elemento de soporte del compresor presenta para la configuración como bandeja de condensación un fondo de bandeja y paredes laterales circundantes y elevadas lateralmente, caracterizado porque el elemento de soporte está configurado de dos piezas con un cuerpo de base en forma…

Adaptador para eliminar puntos de apoyo en un refuerzo de una piscina desmontable.

(22/07/2015) Adaptador para eliminar puntos de apoyo en un refuerzo de una piscina desmontable, donde dicho refuerzo sobresale de una pared de la piscina y presenta al menos parte de su superficie exterior dispuesta de una manera inclinada por la cual es capaz de servir como punto de apoyo y permitir potencialmente a un niño pequeño apoyar el pie y trepar hacia el interior de la piscina , donde el adaptador se caracteriza por que comprende: - una zona inferior de recepción destinada ser montada sobre el punto de apoyo de la superficie exterior del refuerzo y ocultar dicho punto de apoyo , - dos caras externas laterales destinadas a quedar sustancialmente verticales o…

Unidad de envasado para productos como huevos, y molde y método para ello.

(22/07/2015) Unidad de envasado para producto como huevos (P), que comprende: - un cartón fabricado de pulpa moldeada con una parte inferior que comprende compartimentos para productos individuales, y con una parte de cubierta que comprende superficies superior , frontal y posterior ; y - una etiqueta fabricada de cartulina, comprendiendo la etiqueta una superficie frontal extendida, caracterizada por que la superficie frontal extendida de la etiqueta comprende un surco o abertura o entalladura que se corresponde con un saliente proporcionado en la parte inferior de tal manera que se puede conseguir un cierre .

Terapia para el vitíligo.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(22/07/2015). Solicitante/s: Clinuvel Pharmaceuticals Limited. Inventor/es: WOLGEN,PHILIPPE. Clasificación: C07K14/685, A61K38/34, A61K31/505, A61K38/13, A61K31/485, A61P17/00, A61K9/00, A61K31/573, A61K38/21, A61K45/06, A61N5/06, A61K31/58, A61K31/436, A61K31/52, A61K31/37.

Composición farmacéutica que comprende un análogo de alfa-MSH seleccionado del grupo que consiste de: [Nle4, D-Phe7]-alfa MSH [Nle4, D-Phe7]-alfa MSH4-10 [Nle4, D-Phe7]-alfa MSH4-11 [Nle4, D-Phe7-D-Trp9]-alfa MSH4-11, o [Nle4, D-Phe7]-alfa MSH4-9 para uso en el tratamiento o prevención del vitíligo en un sujeto humano en donde la composición farmacéutica es administrada por vía subcutánea en un sistema de suministro de liberación sostenida.

PDF original: ES-2550160_T3.pdf

Procedimiento de neutralización de un catalizador de polimerización.

(22/07/2015) Un procedimiento para limpiar un sistema de preparación de suspensión de catalizador, comprendiendo dicho sistema de preparación de suspensión de catalizador al menos uno o más recipiente(s) de lodos conectado(s) operativamente a un recipiente de mezcla mediante uno o más conductos caracterizado porque el sistema de preparación de la suspensión de catalizador está adaptado para la preparación de un catalizador de metaloceno, cromo o Ziegler-Natta, y está conectado a un reactor de bucle de polimerización, y porque el procedimiento comprende al menos una etapa de aclarado de dicho sistema de preparación de suspensión de catalizador, o una o más de sus partes, con un agente de inactivación de catalizador…

Dispositivo para la fabricación de un fuselaje de avión que comprende un sistema de accionamiento de sectores.

(22/07/2015) Dispositivo para la producción del fuselaje de un avión que comprende un mandril de laminación definido por una superficie externa que define un sólido de rotación con respecto a un eje de simetría ; dicho mandril de laminación está adaptado para recibir y soportar una banda de material sintético impregnado que está depositado y enrollado sobre la superficie externa formando una pluralidad de capas superpuestas que se someten a un proceso de polimerización a alta temperatura al vacío para la formación de una sección estructural del avión; el mandril de laminación comprende una pluralidad de sectores regularmente espaciados alrededor del eje y móviles a lo largo de guías entre: - una posición…

Dispositivo por chorro de agua para la separación de una estructura biológica.

(22/07/2015) Dispositivo por chorro de agua para la separación de una estructura biológica, compuesto de un recipiente de almacenamiento con un líquido de separación, de una unidad de pistón - cilindro con un dispositivo de accionamiento excéntrico y de una pieza de mano de operación , en el que la unidad de pistón - cilindro está conectada con el recipiente de almacenamiento a través de una línea de aspiración y con la pieza de mano de operación a través de una línea de presión , se compone de una carcasa de cilindro y de un pistón adaptado a la carcasa de cilindro y conectado con un dispositivo de accionamiento excéntrico, que configuran ambos una cámara de aspiración y presión , y está conectada…

Biomarcadores para el cáncer de pulmón.

Sección de la CIP Química y metalurgia

(22/07/2015). Solicitante/s: NOVARTIS AG. Inventor/es: KROLL, WERNER, MISSIAGLIA,EDOARDO, WIRAPATI,PRATYAKSHA, ROSSI,SIMONA. Clasificación: C12Q1/68.

Un método para pronosticar en un sujeto cáncer de pulmón de células no pequeñas (CPCNP) que comprende: utilizar una muestra de ensayo obtenida de un sujeto que padece CPCNP después de la resección quirúrgica; determinar el nivel de expresión de una combinación de biomarcadores, en donde la combinación de biomarcadores comprende CBX7, TMPRSS2, GPR116, STX1A, KLK6, SLC16A3, TPX2, UCK2, y PHKA1; y analizar el nivel de expresión para generar una puntuación del riesgo, en donde la puntuación del riesgo se puede utilizar para proporcionar un pronóstico del sujeto.

PDF original: ES-2550192_T3.pdf

Dispositivo para la retroinyección de un implante.

(22/07/2015) Dispositivo para la retroinyección de un implante en la piel de un sujeto, comprendiendo este dispositivo un cuerpo principal hueco al cual está fijada una aguja hueca, en la cual está introducido el implante , un cuerpo secundario situado coaxialmente en el interior del cuerpo principal y que rodea a la aguja , y un vástago de pistón capaz de deslizar coaxialmente en el interior de la citada aguja hueca, proporcionándose medios para permitir que el vástago de pistón mantenga inalterada su posición con respecto a la aguja cuando el dispositivo de retroinyección se presiona contra la piel del sujeto para permitir que la aguja penetre en la piel del citado sujeto y que el cuerpo secundario se retraiga en…