CIP 2015 : C12N 15/09 : Tecnología del ADN recombinante.

CIP2015CC12C12NC12N 15/00C12N 15/09[1] › Tecnología del ADN recombinante.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.

C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00).

C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K).

C12N 15/09 · Tecnología del ADN recombinante.

CIP2015: Invenciones publicadas en esta sección.

Utilización de secuencias de lentivirus de estructura triple para la importación nuclear de secuencias nucleotídicas.

(14/09/2016) Uso o de un polinucleótido para la fabricación de un vector plásmido recombinante destinado a la producción, mediante cotransfección de plásmidos de transcomplementación, de partículas lentivirales recombinantes desprovistas de genes lentivirales y destinadas a la transducción a células eucariotas diana de una secuencia de nucleótidos de interés, partículas donde dicho polinucleótido es el determinante de importación nuclear, estando dicho polinucleótido derivado de un lentivirus y constituido por una región activa en cis de iniciación central (cPPT) que contiene al menos 10 nucleótidos, de una región activa en cis de terminación (CTS) que contiene al menos 10 nucleótidos, y una concatenación interna de nucleótidos…

Derivado de carboximetilpiperidina.

(14/09/2016). Solicitante/s: KISSEI PHARMACEUTICAL CO., LTD.. Inventor/es: SHIMIZU, KAZUO, OHNO,Kohsuke, MIYAGI,Takashi, UENO,YASUNORI, ONDA,YUSUKE, SUZUKI,HIKARU.

Compuesto representado por la fórmula (I): **Fórmula** en la que el anillo A es un grupo representado por la fórmula: **Fórmula** el anillo B es un grupo representado por la fórmula: **Fórmula** con la condición de que los enlaces con (*) son puntos de unión a la fórmula: **Fórmula** los enlaces con (**) son puntos de unión al anillo A; los enlaces con (***) son puntos de unión a la fórmula: **Fórmula** R1 es alquilo C1-6 o alcoxi C1-6; R2 y R3 son cada uno independientemente un átomo de hidrógeno o metilo; n es 0, 1, 2, 3, 4 o 5; o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2671418_T3.pdf

Compuestos flavonoides glicosilados.

(14/09/2016). Solicitante/s: SUNTORY HOLDINGS LIMITED. Inventor/es: FUKAMI, HARUKAZU, NAKAO. MASAHIRO, OCHIAI,MISA, NOGUCHI,AKIO.

Un compuesto que se selecciona del grupo que consiste en: 3-O-galato de 5-O-a6alpha;-D-glucopiranosil- -epigalocatequina; 3-O-galato de 7-O-(4-O-α-D-glucopiranosil-α-D-glucopiranosil)- -epigalocatequina; 4'-O-(4-O-α-D-glucopiranosil-α-D-glucopiranosil)-(+)-catequina; 3'-O- (4-O-α-D-glucopiranosil-α-D-glucopiranosil)-(+)catequina; y 3-O-galato de 3'-O-(4-O-α-D-glucopiranosil-α-D-glucopiranosil)- epigalocatequina.

PDF original: ES-2596777_T3.pdf

Agentes de union selectivos a antígenos de la proteína de unión a osteoprotegerina.

(14/09/2016). Solicitante/s: AMGEN INC.. Inventor/es: BOYLE, WILLIAM, J., DESHPANDE,RAJENDRA,V, HITZ,ANNA, SULLIVAN,JOHN,KEVIN.

Un anticuerpo o dominio de unión a antígeno que reconoce un epítopo DE en proteína de unión a osteoprotegerina humana (OPGbp), a) siendo el epítopo DE un epítopo que comprende una porción de la secuencia de aminoácido de la región DE de OPGbp humana desde el radical de aminoácido 212 hasta el radical de aminoácido 250 de la secuencia GFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP, y b) comprendiendo el epítopo DE la secuencia DLATE.

PDF original: ES-2307594_T5.pdf

PDF original: ES-2307594_T3.pdf

Procedimiento de producción viral.

(07/09/2016). Solicitante/s: CANJI, INC.. Inventor/es: SHABRAM, PAUL, W., GIROUX, DANIEL, D., GOUDREAU, ANN, M., RAMACHANDRA, MURALIDHARA.

Procedimiento para la obtención de una densidad celular superior a 5 x 106 células productoras/ml en un microvehículo de dextrano reticulado basado en el procedimiento de biorreactor para la producción de un virus en una célula productora, comprendiendo dicho procedimiento las etapas siguientes: a)preparar un cultivo de células productoras unidas a los microvehículos de dextrano reticulados en el que la proporción de células productoras a los microvehículos es de aproximadamente 10 células/microvehículo, b)sembrar el biorreactor con una cantidad de microvehículos recubiertos de células productoras preparados en la etapa (a) hasta una densidad superior a aproximadamente 6 gramos (basada en el peso seco del microvehículo) de microvehículos recubiertos de célula productora por litro de volumen del medio del biorreactor; y c)cultivar las células productoras en el biorreactor bajo condiciones de perfusión en un medio que contiene suero hasta una densidad superior a 100 células/microvehículo.

PDF original: ES-2257861_T5.pdf

PDF original: ES-2257861_T3.pdf

Vectores de expresión y métodos para producir altos niveles de proteínas.

(07/09/2016). Solicitante/s: CADILA HEALTHCARE LIMITED. Inventor/es: SINGH,ARUN K, GOEL,ASHISH, MENDIRATTA,SANJEEV K.

Un proceso para la alta expresión de una proteína de interés utilizando un vector de expresión que comprende al menos los siguientes elementos reguladores: a) un promotor CMV, b) in intrón, c) TPL, d) genes VA, y e) una secuencia de poliadenilación de hormona de crecimiento bovina.

PDF original: ES-2605358_T3.pdf

Producción in vivo de ARN de interferencia pequeños que median el silenciamiento génico.

(07/09/2016). Solicitante/s: UNIVERSITY OF MASSACHUSETTS. Inventor/es: HUTVAGNER,GYORGY, ZAMORE,PHILIP D, MCLACHLAN,JUANITA, MELLO,CRAIG C, GRISHOK,ALLA.

Método para preparar un precursor de ARN manipulado para uso en la mediación de la interferencia de ácido ribonucleico (ARNi) de un gen diana de una célula de mamífero, que comprende modificar una secuencia precursora de ARNts de origen natural para producir un precursor de ARN manipulado que comprende i) una primera porción de tallo que comprende una secuencia de 18 a 40 nucleótidos que es sustancialmente complementaria a una secuencia de un ARN mensajero (ARNm) del gen diana; ii) una segunda porción de tallo que comprende una secuencia de 18 a 40 nucleótidos que es suficientemente complementaria a la secuencia de 18 a 40 nucleótidos de la primera porción de tallo para hibridar con la primera porción de tallo para formar un tallo dúplex; y iii) una porción de bucle de al menos 4 nucleótidos que conecta las dos porciones de tallo; en el que el precursor es capaz de ser procesado por Dicer.

PDF original: ES-2606290_T3.pdf

Método para la detección de un cáncer.

(07/09/2016). Solicitante/s: TORAY INDUSTRIES, INC.. Inventor/es: OKANO, FUMIYOSHI, SUZUKI,KANA.

Un metodo para detectar un cancer (o canceres) que se aplica a una muestra separada de un cuerpo vivo y que comprende medir una expresion de al menos un polipeptido, en el que el polipeptido: (i) se produce en dicho cuerpo vivo; (ii) tiene reactividad para unirse a un anticuerpo frente a un polipeptido que tiene la secuencia de aminoacidos mostrada en las SEQ ID NO: 2 o 4 mediante reaccion antigeno-anticuerpo; y (iii) tiene la secuencia de aminoacidos mostrada en la SEQ ID NO: 2 o una homologia de no menos del 95 % con la misma, en donde el termino "homologia" significa un valor expresado como un porcentaje que se calcula alineando dos secuencias de aminoacidos a comparar, de forma que el numero de restos de aminoacidos que coinciden sea el maximo, y dividiendo el numero de restos de aminoacidos que coinciden por el numero total de restos de aminoacidos, contando cuando sea aplicable un hueco como un resto de aminoacido.

PDF original: ES-2605646_T3.pdf

Sondas conjugadas y detección óptica de analitos.

(07/09/2016). Solicitante/s: TROVAGENE, INC. Inventor/es: LI,ZHENG, LIU,ZHIPING.

Una matriz para detectar analitos con un sensor de imágenes, comprendiendo la matriz: - un sensor de imágenes digital óptico semiconductor de óxido metálico complementario (CMOS) que comprende como su capa superior una capa de pasivación transparente; y - una pluralidad de sondas de conjugados unidas covalentemente con dicha capa de pasivación transparente; donde al menos un conjugado de la pluralidad de conjugados comprende un resto de sonda de unión a diana acoplado covalentemente con un polímero.

PDF original: ES-2593683_T3.pdf

Composición de anticuerpo modificado.

(31/08/2016). Solicitante/s: KYOWA HAKKO KIRIN CO., LTD.. Inventor/es: NIWA,Rinpei , TSUCHIYA MAMI.

Composición de variante de anticuerpo y fragmento de la composición de variante de anticuerpo, que comprende los residuos de aminoácidos de una secuencia Asn-X-Ser/Thr (X representa un residuo de aminoácido diferente de Pro) en una región Fc de un anticuerpo IgG humano, realizándose en dicha secuencia Asn-X-Ser/Thr por lo menos una sustitución de aminoácido seleccionada de entre una sustitución de aminoácido de Asn por otro residuo de aminoácido, una sustitución de aminoácido de X por Pro y una sustitución de aminoácido de Ser/Thr por otro residuo de aminoácido, en la/el que la secuencia Asn-X-Ser/Thr (X es un residuo de aminoácido diferente de Pro) son los residuos de aminoácidos en las posiciones 392 a 394 según el índice EU, y en la/el que la región Fc de un anticuerpo IgG humano comprende la secuencia de aminoácidos de SEC ID nº 1.

PDF original: ES-2602971_T3.pdf

Aptámero contra IL-17 y uso del mismo.

(31/08/2016). Solicitante/s: The University of Tokyo. Inventor/es: NAKAMURA,YOSHIKAZU, OHUCHI,SHOJI, ISHIGURO,AKIRA.

Un aptámero que se une a IL-17 y/o inhibe la unión de IL-17 y el receptor de IL-17, en donde: (a) el aptámero comprende una secuencia de nucleótidos de la SEQ ID NO: 58, SEQ ID NO: 59 o SEQ ID NO: 60; (b) el aptámero comprende una secuencia de nucleótidos seleccionada de entre las SEQ ID NO: 3 a 5, 22 a 28, 32 a 36, 45 a 48, 50 y 51 (con la condición de que el uracilo puede ser timina); o (c) el aptámero comprende una secuencia de nucleótidos seleccionada de entre las SEQ ID NO: 3 a 5, 22 a 28, 32 a 36, 45 a 48, 50 y 51 (con la condición de que el uracilo puede ser timina) en donde se sustituyen, suprimen, insertan o añaden uno de cinco nucleótidos, y cada grupo hidroxi en la posición 2' de la ribosa de los nucleótidos contenidos en el aptámero (a) - (c) anteriores está independientemente sin sustituir o sustituido con un átomo o un grupo seleccionado del grupo que consiste en un átomo de hidrógeno, un grupo metoxi y un átomo de flúor.

PDF original: ES-2602119_T3.pdf

Procedimiento para controlar la actividad de una molécula inmunofuncional.

(31/08/2016) Procedimiento para controlar la citotoxicidad celular dependiente de anticuerpos (ADCC) de una mezcla de anticuerpos IgG F0, F1 y F2 en una célula anfitriona, animal no humano o planta, comprendiendo dicho procedimiento regular la presencia o ausencia de unión de la fucosa a la N-acetilglucosamina del extremo reductor de una cadena de azúcar unida a N-glucósido de tipo complejo biantenaria eliminando un gen que codifica una α1,6-fucosiltransferasa en la célula anfitriona, animal no humano o planta, o añadiendo una mutación al gen para reducir o eliminar la actividad enzimática en la célula anfitriona, animal no humano o planta, en el que dicha cadena de azúcar…

Método para modificar el punto isoeléctrico de un anticuerpo mediante la sustitución de aminoácidos en una CDR.

(24/08/2016). Solicitante/s: CHUGAI SEIYAKU KABUSHIKI KAISHA. Inventor/es: TSUNODA,Hiroyuki , IGAWA,Tomoyuki , KURAMOCHI,TAICHI, TACHIBANA,TATSUHIKO.

Un método para controlar la farmacocinética en plasma de un anticuerpo IgG conservando al mismo tiempo la actividad de unión a antígeno de la región variable, comprendiendo dicho método modificar la carga de al menos un resto de aminoácido que puede exponerse en la superficie de una región determinante de complementariedad (CDR) del anticuerpo, en el que el resto de aminoácido que puede exponerse en la superficie de la región CDR es al menos un resto de aminoácido seleccionado de restos de aminoácidos en las posiciones 31, 61, 62, 64 y 65 en la región variable de cadena pesada y posiciones 24, 27, 53, 54 y 55 en la región variable de cadena ligera de acuerdo con el sistema de numeración de Kabat.

PDF original: ES-2595638_T3.pdf

Enzimas que tienen actividad de alfa amilasa y métodos de uso de las mismas.

(24/08/2016) Un ácido nucleico aislado, sintético o recombinante que comprende: (A) (i) una secuencia que codifica un polipéptido que tiene actividad de alfa amilasa, en la que dicha secuencia tiene por lo menos 95%, 96%, 97%, 98%, 99% o 100% de identidad de secuencia con la secuencia de la SEQ ID NO: 77 o fragmentos enzimáticamente activos de la misma, en la que el fragmento tiene actividad de alfa amilasa, o (ii) la secuencia de (i), en la que se determina la identidad de secuencia mediante análisis con un algoritmo de comparación de secuencia, o se determina mediante inspección visual, o (iii) la secuencia de (ii), en la que el algoritmo de comparación de secuencia comprende un algoritmo 3.0t78 de versión…

Proteína asociada a enfermedad.

(17/08/2016). Solicitante/s: NOVARTIS AG. Inventor/es: LEVEILLARD,THIERRY, MOHAND-SAID,SADDEK, HICKS,DAVID.

Una composición farmacéutica que comprende una cantidad terapéuticamente eficaz de un polipéptido seleccionado del grupo de SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12 y SEQ ID NO:14, y un vehículo farmacéuticamente aceptable.

PDF original: ES-2597835_T3.pdf

Colágeno modificado con retinol, método para producir el mismo, y composición externa para la piel que lo contiene.

(17/08/2016). Solicitante/s: National University Corporation Nara Institute of Science and Technology. Inventor/es: YAMAMOTO, KAZUSHI, TANIHARA,MASAO, TAKAICHI,KANA, MAEDA,MARIKO, MITSUI,TSUKASA, HIRANO,AKIKO.

Un colágeno modificado con retinol que comprende una unidad peptídica representada por la fórmula :**Fórmula** y que opcionalmente también comprende al menos un tipo de una unidad peptídica representada por la fórmula :**Fórmula** y una unidad peptídica representada por la fórmula :**Fórmula**.

PDF original: ES-2589003_T3.pdf

Métodos de ensamblaje dinámico de vectores para la clonación de ADN de vectores plasmídicos.

(17/08/2016) Un método para sintetizar simultáneamente una matriz de transgenes, que comprende las etapas de: a. proporcionar un vector plasmídico de clonación primario que comprende un armazón, comprendiendo el armazón (i) al menos un primer punto de acoplamiento y un segundo punto de acoplamiento estando cada punto de acoplamiento fijado en el armazón y que comprenden al menos un sitio de restricción raro de más de 6 nucleótidos para una enzima de restricción rara no variable y (ii) un único sitio para HE en orientación directa localizado secuencia arriba desde el extremo 5' del primer punto de acoplamiento y un único sitio para HE en orientación inversa localizado secuencia abajo desde el extremo 3' del segundo punto de acoplamiento; b. escindir el primer punto de acoplamiento con una primera enzima de restricción rara no variable que se corresponde…

Moléculas de anticuerpo que tienen especificidad por el factor de necrosis tumoral alfa humano y sus usos.

(10/08/2016). Solicitante/s: UCB PHARMA, S.A.. Inventor/es: CHAPMAN, ANDREW PAUL, KING, DAVID JOHN, ATHWAL, DILJEET, SINGH, WEIR,ANDREW NEIL CHARLES, BROWN,DEREK THOMAS, POPPLEWELL,ANDREW GEORGE.

Una molécula de anticuerpo que tiene especificidad por el TNFα humano, que tiene una cadena ligera que tiene la secuencia dada en SEC ID NO:113 y una cadena pesada que tiene la secuencia dada en SEC ID NO:115 en donde una molécula efectora o reportera está unida al extremo C terminal de la cadena pesada.

PDF original: ES-2600080_T3.pdf

Anticuerpo anti-CD4.

(10/08/2016) Anticuerpo monoclonal frente a CD4 humano, presentando dicho anticuerpo una constante de disociación (KD) inferior a 1 x 10-9 M, se une a una región extracelular de CD4 humano, y es: (i) un anticuerpo híbrido humano recombinante en el que la región variable de cadena pesada (VH) del anticuerpo comprende la secuencia de aminoácidos de SEC ID nº: 12 pero que excluye la secuencia señal secretora de aminoácidos 1 a 19 en SEC ID nº: 12, y la región variable de cadena ligera (VL) del anticuerpo comprende la secuencia de aminoácidos de SEC ID nº: 22 pero que excluye la secuencia señal secretora de aminoácidos 1 a 20 en 10 SEC…

Mejoramiento genético inverso.

(10/08/2016) Método para producir de manera eficaz plantas homocigotas a partir de una planta de partida heterocigota, que comprende: a) proporcionar una planta de partida heterocigota; b) permitir que la planta de partida produzca células haploides a la vez que evita o suprime al menos parcialmente la aparición de recombinación con el fin de obtener un número limitado de células haploides genéticamente diferentes; c) crear plantas homocigotas a partir de las células haploides obtenidas de ese modo; y d) seleccionar las plantas que tienen el conjunto deseado de cromosomas, en donde la prevención o supresión de la recombinación se consigue: - interfiriendo con uno o más genes…

Anticuerpo que presenta una actividad ADCC mejorada.

(10/08/2016). Solicitante/s: LABORATOIRE FRANCAIS DU FRACTIONNEMENT ET DES BIOTECHNOLOGIES. Inventor/es: BOUREL, DOMINIQUE, BIHOREAU, NICOLAS, GLACET,ARNAUD, DE ROMEUF,Christophe, NONY,Emmanuel, BELLIARD,ROLAND.

Composición que comprende un anticuerpo monoclonal, caracterizada por que dicho anticuerpo posee en su sitio de glicosilación (Asn 297) del Fcγ unas estructuras glicánicas de tipo biantenadas, con unas cadenas cortas, una baja sialilación, unas manosas y GlcNAc del punto de enganche terminales no intermedios, caracterizada por que comprende una cantidad superior al 60% para las formas G0 + G1 + G0F + G1F:**Fórmula** y en la que el contenido en fucosa es inferior al 30%.

PDF original: ES-2601241_T3.pdf

Anticuerpo modificado con bioactividad mejorada.

(10/08/2016). Solicitante/s: The Chemo-Sero-Therapeutic Research Institute. Inventor/es: MASUHO,YASUHIKO, NAGASHIMA,HIROAKI.

Un método para mejorar una actividad efectora de un anticuerpo, en donde una o más estructuras que comprenden un dominio Fc de IgG1 humana están enlazadas en tándem al extremo terminal C de una cadena pesada de anticuerpo por una técnica de ingeniería genética, en donde la actividad efectora es actividad de citotoxicidad celular dependiente del anticuerpo (actividad de ADCC), siempre y cuando una estructura que comprende un dominio Fc de IgG1 humana esté enlazada en tándem al extremo terminal C de dicha cadena pesada de anticuerpo, dicha estructura que comprende un dominio Fc de IgG1 humana comprende un espaciador flexible de glicina/serina de residuos de amino ácidos, en donde la unidad básica consiste en cuatro glicinas y una serina, cinco aminoácidos en total, en el lado N-terminal del dominio Fc de la IgG1 humana.

PDF original: ES-2602439_T3.pdf

Agente inmunoinductor.

(03/08/2016). Solicitante/s: TORAY INDUSTRIES, INC.. Inventor/es: OKANO, FUMIYOSHI, KURIHARA, AKIRA.

Un agente inmunoinductor para su uso en un método de tratamiento médico o veterinario, comprendiendo el agente inmunoinductor como principio(s) eficaz(ces) al menos un polipéptido que tiene actividad inmunoinductora seleccionado de entre los polipéptidos (a) a (b) más adelante y/o un(os) vector(es) recombinante(s) que comprende(n) un(os) polinucleótido(s) que codifica(n) dicho al menos un polipéptido, siendo capaz(ces) dicho(s) vector(es) recombinante(s) de expresar in vivo dicho(s) polipéptido(s): (a) un polipéptido que tiene una secuencia de aminoácidos de una cualquiera de las SEQ ID NO:4, 2, 8, 10 y 12; (b) un polipéptido que tiene una identidad de secuencia de no menos del 85 % con el polipéptido (a).

PDF original: ES-2595161_T3.pdf

Método para la expresión de moléculas de ARN pequeño dentro de una célula.

(03/08/2016). Solicitante/s: CALIFORNIA INSTITUTE OF TECHNOLOGY. Inventor/es: BALTIMORE,DAVID, QIN,XIAO-FENG, LOIS-CABALLE,CARLOS.

Un método de expresión de una molécula de ARN dentro de una célula, comprendiendo el método: transfectar una línea celular de encapsidación con una construcción retroviral; recuperar un retrovirus recombinante de la línea celular de encapsidación; e infectar una célula diana in vitro con el retrovirus recombinante, en el que la construcción retroviral comprende las secuencias R y U5 de una repetición terminal larga (LTR) lentiviral de 5', una LTR de 3' lentiviral auto-inactivante, un primer promotor de ARN polimerasa III, una secuencia de terminación de ARN polimerasa III y un transgén que comprende una primera región codificante de ARN operativamente unida a la primera región del promotor de ARN polimerasa III, y en el que el promotor de ARN polimerasa III y la región codificante de ARN están situadas entre la LTR de 5' y la LTR de 3'.

PDF original: ES-2601141_T3.pdf

Nuevas composiciones inmunogénicas para la prevención y tratamiento de enfermedad meningocócica.

(27/07/2016). Solicitante/s: WYETH HOLDINGS LLC. Inventor/es: METCALF, BENJAMIN J., ZLOTNICK, GARY W., ZAGURSKY,ROBERT J, FLETCHER,LEAH D, FARLEY,JOHN, BERNFIELD,LIESEL A.

Una composición que comprende: al menos una proteína aislada que comprende la secuencia de aminoácidos de SEQ ID NO: 301; en la que x es cualquier aminoácido; en la que la región de la posición de aminoácido a la posición de aminoácido 8 es cualquiera de 0 a 4 aminoácidos; en la que la región de la posición de aminoácido 66 a la posición de aminoácido 68 es cualquiera de 0 a 3 aminoácidos; a condición de que dicha proteína no sea SEQ ID NO: 1, 5, 7, 9, 14, 15, 17, 18, 19, 20 o 22 del documento WO03/020756; para uso como un medicamento.

PDF original: ES-2593360_T3.pdf

Remodelación y glicoconjugación de factor estimulante de colonias de granulocitos (G-CSF).

(13/07/2016). Solicitante/s: RATIOPHARM GMBH. Inventor/es: BAYER, ROBERT, CHEN, XI, HAKES,David, DE FREES,Shawn, ZOPF,David, BOWE,Caryn.

Un procedimiento de formación de un conjugado entre un péptido de factor estimulante de colonias de granulocitos (G-CSF) y un polímero hidrosoluble, en el que el polímero hidrosoluble se une covalentemente al péptido mediante un grupo enlazador de glicosilo intacto, comprendiendo el péptido un resto de glicosilo que tiene la fórmula:**Fórmula** en la que a, b, c y e son miembros seleccionados independientemente entre 0 y 1; d es 0; y R es un polímero hidrosoluble, comprendiendo dicho procedimiento: (a) poner en contacto el péptido de G-CSF con una glicosiltransferasa y un donante de glicosilo modificado, que comprende un resto de glicosilo que es un sustrato para la glicosiltransferasa unida covalentemente al polímero hidrosoluble en condiciones adecuadas para la formación del grupo enlazador de glicosilo intacto; en el que el polímero hidrosoluble es un poli(éter).

PDF original: ES-2606840_T3.pdf

Oligorribonucleótido para inhibir la expresión de un gen predeterminado.

(13/07/2016). Solicitante/s: ALNYLAM EUROPE AG. Inventor/es: KREUTZER, ROLAND DR., LIMMER, STEPHAN.

Oligorribonucleótido con estructura de hebra doble (dsARN) para inhibir la expresión de un gen diana predeterminado en células de mamíferos, donde el dsARN presenta entre 15 y 49 pares de bases, y una hebra del dsARN presenta una región I complementaria al gen diana al menos por segmentos, la cual presenta como máximo 49 pares de nucleótidos sucesivos, y una región II complementaria dentro de la estructura de hebra doble está formada por dos hebras individuales separadas de ARN, donde los nucleótidos del dsARN están modificados, donde al menos un grupo 2'-hidroxilo de los nucleótidos del dsARN está reemplazado por un grupo químico en la región complementaria II.

PDF original: ES-2597953_T3.pdf

Método para la producción de proteínas heterogéneas.

(13/07/2016). Solicitante/s: CHUGAI SEIYAKU KABUSHIKI KAISHA. Inventor/es: TABUCHI,HISAHIRO, SUGIYAMA,TOMOYA.

Un método para producir un polipéptido deseado, que comprende transferir artificialmente un gen de alanina aminotransferasa y un gen que codifica un polipéptido deseado a una célula y cultivar dicha célula que expresa dicha alanina aminotransferasa y tiene un ADN transferido que codifica el polipéptido deseado y que permite de ese modo a la célula producir dicho polipéptido deseado, en donde la célula que expresa la alanina aminotransferasa es una célula que es transformada por un vector que incorpora un ADN que codifica dicha alanina aminotransferasa, en donde el polipéptido deseado es un anticuerpo.

PDF original: ES-2591284_T3.pdf

Anticuerpos anti-Abeta y su uso.

(06/07/2016). Solicitante/s: F. HOFFMANN-LA ROCHE AG. Inventor/es: HUBER, WALTER, KRETZSCHMAR, TITUS, LOETSCHER,Hansruedi, BROCKHAUS,Manfred, BOHRMANN,Bernd, ROTHE CHRISTINE, BARDROFF,MICHAEL, LÖHNING,CORINNA, NORDSTEDT,CHRISTER.

Una molécula de anticuerpo anti-péptido beta-A4 que comprende: (a) una región variable VL que comprende regiones determinantes de complementariedad, L-CDR1, L-CDR2 y LCDR3, en donde: L-CDR1 comprende SEQ ID NO: 143: Arg Ala Ser Gln Ser Val Ser Ser Ser Tyr Leu Ala; L-CDR2 comprende SEQ ID NO: 144: Gly Ala Ser Ser Arg Ala Thr; y L-CDR3 comprende SEQ ID NO: 95: Leu Gln Ile Tyr Asn Met Pro Ile; y (b) una región VH variable que comprende regiones determinantes de complementariedad, H-CDR1, H-CDR2 y CDR3, en donde: H-CDR1 comprende SEQ ID NO: 146: Gly Phe Thr Phe Ser Ser Tyr Ala Met Ser; H-CDR2 comprende SEQ ID NO: 192: Ala Ile Asn Ala Ser Gly Thr Arg Thr Tyr Tyr Ala Asp Ser Val Lys Gly; y H-CDR3 comprende SEQ ID NO: 93: Gly Lys Gly Asn Thr His Lys Pro Tyr Gly Tyr Val Arg Tyr Phe Asp Val.

PDF original: ES-2590684_T3.pdf

Anticuerpo anti-NR10 y uso del mismo.

(06/07/2016). Solicitante/s: CHUGAI SEIYAKU KABUSHIKI KAISHA. Inventor/es: TSUNODA,Hiroyuki , IGAWA,Tomoyuki , KURAMOCHI,TAICHI, SHIRAIWA,HIROTAKE, TACHIBANA,TATSUHIKO, KASUTANI,KEIKO, OHYAMA,SOUHEI, ESAKI,KEIKO.

Un anticuerpo anti-NR10/IL-31RA neutralizante que reconoce la región de aminoácidos entre las posiciones 21 y 120 de la secuencia de aminoácidos de NR10/IL-31RA humano de SEQ ID Nº: 76, en el que el anticuerpo comprende la región variable de la cadena pesada de SEQ ID Nº: 12 y la región variable de la cadena ligera de SEQ ID Nº: 16.

PDF original: ES-2585480_T3.pdf

Sistema automatizado para aislar, amplificar y detectar una secuencia blanco de ácidos nucleicos.

(06/07/2016) Un sistema completamente automatizado para tratar un componente de interés contenido en al menos una muestra, que comprende: una estación de separación que comprende un dispositivo de extracción, adaptado para recibir y extraer el componente de interés de dicha muestra cuando la muestra está dispuesta en un tubo; una estación de incubación de amplificación que comprende un calentador y un instrumento prensor de junta de placa, estando la estación de amplificación adaptada para recibir una placa de amplificación que comprende una pluralidad de pocillos; una estación de detección, adaptada para detectar la presencia de dicho componente de interés extraído por dicho dispositivo de extracción, estando la estación…

Vacunas que comprenden transgenes sensibles al calor.

(29/06/2016). Solicitante/s: UVic Industry Partnerships Inc. Inventor/es: NANO,FRANCIS E.

Una bacteria sensible a la temperatura (TS), donde la bacteria sensible a la temperatura es una bacteria mesófila que comprende una o más secuencias codificantes de ácidos nucleicos esenciales que codifican un polipéptido a partir de una bacteria psicrófila, donde dichas secuencias codificantes de ácidos nucleicos se insertan en el genoma de dicha bacteria mesófila por recombinación homóloga sustituyendo así funcionalmente el homólogo de la bacteria mesófila del polinucleótido esencial TS y donde dicha bacteria sensible a la temperatura mesófila es para su uso en la producción de una respuesta inmunitaria a la bacteria sensible a la temperatura mesófila en un sujeto.

PDF original: ES-2594485_T3.pdf

‹‹ · 4 · 6 · · 8 · · 10 · 13 · 19 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015