CIP 2015 : C07K 16/30 : de células tumorales.

CIP2015CC07C07KC07K 16/00C07K 16/30[3] › de células tumorales.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C07 QUIMICA ORGANICA.

C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales.

C07K 16/30 · · · de células tumorales.

CIP2015: Invenciones publicadas en esta sección.

Anticuerpos monoclonales para su uso en el diagnóstico y la terapia de cánceres y enfermedades autoinmunitarias.

(27/02/2019). Solicitante/s: BOARD OF REGENTS THE UNIVERSITY OF TEXAS SYSTEM. Inventor/es: MOLLDREM,JEFFREY, SERGEEVA,ANNA.

Un anticuerpo humanizado que se une a VLQELNVTV (SEQ ID NO: 45) cuando esta unido a un receptor HLA-A2, comprendiendo dicho anticuerpo una region variable de la cadena pesada que consiste en la secuencia de aminoacidos que se muestra en SEQ ID NO:16, y una region variable de la cadena ligera que comprende las secuencias de aminoacidos que se muestran en las SEQ ID NOS: 19 o 20.

PDF original: ES-2720291_T3.pdf

Eliminación de células tumorales de la recuperación de sangre autóloga intraoperatoria.

(27/02/2019) Procedimiento ex vivo para la eliminación de células tumorales de la sangre recuperada intraoperatoriamente que comprende las siguientes etapas: - proporcionar la sangre recuperada intraoperatoriamente, la cual puede contener células tumorales; - poner en contacto dicha sangre recuperada intraoperatoriamente con - al menos un anticuerpo biespecífico trifuncional que comprende las siguientes propiedades: a) unión a una célula T; b) unión a un antígeno asociado a un tumor o a una célula tumoral; c) unión por medio de su porción Fc a una célula positiva de un receptor Fc, siendo dicho anticuerpo capaz de formar una red tridimensional con las células tumorales…

Anticuerpos anti-CDH3 y sus usos.

(25/02/2019). Solicitante/s: ONCOTHERAPY SCIENCE, INC.. Inventor/es: YAMAMOTO, SHINJI, NAKAMURA, YUSUKE, ENDO,KEIGO, OHSAWA,RYUJI, YOSHIOKA,HIROKI, NG,POHSING, SHIBA,YASUHIRO, KUDO,AIKO.

Un anticuerpo o su fragmento, en el que el anticuerpo o su fragmento comprende una región V de la cadena H que comprende CDR1 que tiene la secuencia de aminoácidos mostrada en SEQ ID NO: 6, CDR2 que tiene la secuencia de aminoácidos mostrada en SEQ ID NO: 8 y CDR3 que tiene la secuencia de aminoácidos mostrada en SEQ ID NO: 10, y una región V de la cadena L que comprende CDR1 que tiene la secuencia de aminoácidos mostrada en SEQ ID NO: 14, CDR2 que tiene la secuencia de aminoácidos mostrada en SEQ ID NO: 16 y CDR3 que tiene la secuencia de aminoácidos mostrada en SEQ ID NO: 18 y en el que el anticuerpo o su fragmento es capaz de unirse a un polipéptido CDH3.

PDF original: ES-2701626_T3.pdf

Conjugados anticuerpo-fármaco e inmunotoxinas.

(21/02/2019). Solicitante/s: Oncomatryx Biopharma, S.L. Inventor/es: FABRE,MYRIAM, KONTERMANN,ROLAND,DR, Pfizenmaier,Klaus, SIMON,LAUREANO, FERRER,CRISTINA.

Un conjugado anticuerpo-farmaco que tiene la formula I: A-(L-D)p (I) o una sal o un solvato farmaceuticamente aceptables del mismo, en donde: A es un anticuerpo que se une de manera selectiva a la endoglina; L es un enlazador; p es de 1 a 10; y D es un farmaco que comprende una citolisina de formula IV:**Fórmula** en donde: R2 es H o alquilo C1-C4; R6 es alquilo C1-C6; R7 es alquilo C1-C6, CH2OR19 o CH2OCOR20, en donde R19 es alquilo, R20 es alquenilo C2-C6, fenilo o CH2- fenilo; R9 es alquilo C1-C6; R10 es H, OH, O-alquilo u O-acetilo; f es 1 o 2; R11 tiene la siguiente estructura**Fórmula** en donde R21 es H, OH, halogeno, NH2, alquiloxi, fenilo, alquilamino o dialquilamino; R16 es H o un grupo alquilo C1-C6; R17 esta unido directa o indirectamente al enlazador L; y q es 0, 1, 2 o 3.

PDF original: ES-2701188_T3.pdf

Proteínas multifuncionales que comprenden MHC de clase I multivalente unida por disulfuro.

(20/02/2019) Una proteína multifuncional multivalente unida por disulfuro, caracterizada por que comprende - uno o dos dominios presentadores de antígeno, - una región Fc de anticuerpo, y - uno o más sitios de unión a antígeno, en la que el dominio presentador de antígeno comprende en la dirección N a C terminal bien (i) una microglobulina ß2, y (ii) los dominios extracelulares α1, α2 y α3 de una molécula de MHC de clase I con una frecuencia relativa de menos de un 1 %, o (i) los dominios extracelulares α1, α2 y α3 de una molécula de MHC de clase I con una…

Composición que comprende dos anticuerpos genomanipulados para que tengan una función efectora reducida e incrementada.

(20/02/2019). Solicitante/s: ROCHE GLYCART AG. Inventor/es: KLEIN, CHRISTIAN, DR., UMANA,PABLO, NICOLINI,VALERIA G, GERDES,CHRISTIAN.

Una combinación de (a) un inmunoconjugado que comprende un primer anticuerpo genomanipulado para que tenga una función efectora reducida y un resto efector, y (b) un segundo anticuerpo genomanipulado para que tenga una función efectora incrementada, para su uso en el tratamiento del cáncer en un individuo que lo necesita, en la que el primer anticuerpo se dirige a un antígeno presentado en una célula tumoral o en un entorno de células tumorales y el segundo anticuerpo se dirige a un antígeno presentado en una célula tumoral, y en la que el resto efector es un resto efector IL-2 mutante que comprende al menos una mutación aminoacídica que reduce o anula la afinidad del resto efector IL-2 mutante por la subunidad α del receptor de IL-2, pero conserva la afinidad del resto efector IL-2 mutante por el receptor de IL-2 de afinidad intermedia, en comparación con el resto efector IL-2 no mutada.

PDF original: ES-2700978_T3.pdf

Anticuerpos humanizados para liv-1 y uso de los mismos para tratar el cáncer.

(20/02/2019). Solicitante/s: SEATTLE GENETICS, INC. Inventor/es: SUSSMAN,DJANGO, SMITH,MARIA LEIA, ARTHUR,WILLIAM, NESTEROVA,ALBINA.

Un anticuerpo humanizado que comprende una región variable de cadena pesada madura que tiene una secuencia de aminoácidos que comprende la SEQ ID NO: 10 y una región variable de cadena ligera madura que tiene una secuencia de aminoácidos que comprende la SEQ ID NO: 15.

PDF original: ES-2719548_T3.pdf

Anticuerpo anti-CD19 que tiene funciones ADCC y CDC y perfil de glicosilación mejorado.

(14/02/2019). Solicitante/s: International-Drug-Development-Biotech. Inventor/es: VERMOT-DESROCHES,CLAUDINE, VUILLERMOZ,BORIS SEBASTIEN.

Anticuerpo anti-CD19 modificado para comprender una región Fc de IgG1 humana variante, en el que: Phe243 está sustituido por Leu, Arg292 está sustituido por Pro, Tyr300 está sustituido por Leu, Val305 está sustituido por Leu, Lys326 está sustituido por Ala y Pro396 está sustituido por Leu, o en el que, Phe243 está sustituido por Leu, Arg292 está sustituido por Pro, Tyr300 está sustituido por Leu, Val305 está sustituido por Leu, Lys326 está sustituido por Ala, Pro396 está sustituido por Leu y Glu333 está sustituido por Ala, en el que la numeración de los residuos de aminoácidos en la región Fc es la de Kabat, y en el que el anticuerpo tiene actividad ADCC y CDC.

PDF original: ES-2700294_T3.pdf

Anticuerpos biespecíficos específicos para FAP y DR5, anticuerpos específicos para DR5 y procedimientos de uso.

(13/02/2019). Solicitante/s: ROCHE GLYCART AG. Inventor/es: GEORGES, GUY, SEEBER, STEFAN, KLEIN, CHRISTIAN, DR., UMANA,PABLO, FERRARA KOLLER,CLAUDIA, BRUENKER,PETER, MOESSNER,EKKEHARD, WALDHAUER,INJA, HOSSE,RALF, PACKMAN,KATHRYN E, MOELLEKEN,JOERG, DAOUTI,SHERIF, FENG,NINGPING, GRAU-RICHARDS,SANDRA, KOENIG,MAXIMILIANE, NIU,HUIFENG, RUNZA,VALERIA, WANG,HUISHENG, WEISER,BARBARA.

Un anticuerpo que se une específicamente a DR5, que comprende (a) una región determinante de la complementariedad 1 (CDR1) de la cadena pesada de SEQ ID NO.:1; (b) una región determinante de la complementariedad 2 (CDR2) de la cadena pesada de SEQ ID NO.:2; (c) una región determinante de la complementariedad 3 (CDR3) de la cadena pesada seleccionada del grupo de SEQ ID NO.:3, SEQ ID NO.:96, SEQ ID NO.:98, SEQ ID NO.: 104 y SEQ ID NO.: 108; (d) una CDR1 de la cadena ligera de SEQ ID NO.:4; (e) una CDR2 de la cadena ligera de SEQ ID NO.:5; y (f) una CDR3 de la cadena ligera seleccionada del grupo de SEQ ID NO.:6, SEQ ID NO.:99, SEQ ID NO.: 105, SEQ ID NO.: 109 y SEQ ID NO.:97.

PDF original: ES-2720433_T3.pdf

Anticuerpos específicos para la CLL-1.

(08/02/2019). Solicitante/s: CELLERANT THERAPEUTICS, INC. Inventor/es: JIANG,PING, KARSUNKY,HOLGER, TRESSLER,ROB.

Un anticuerpo aislado que se une específicamente al dominio extracelular de la molécula 1 semejante a lectina de tipo C (CLL-1) humana, en donde el anticuerpo se une a un polipéptido que consiste en el dominio C de lectina de la CLL-1 humana con una Kd al menos 5 veces mayor que un polipéptido que consiste en los dominios de lectina C y de pedúnculo de la CLL-1 humana, en donde el anticuerpo se selecciona del grupo que consiste en: un anticuerpo que comprende las regiones determinantes de complementariedad (CDR) de cadena pesada H1-H3 de las SEQ ID NO:51, 59 y 67, y las CDR de cadena ligera L1-L3 de las SEQ ID NO:75, 83 y 91; y un anticuerpo que comprende las CDR de cadena pesada H1-H3 de las SEQ ID NO:52, 60 y 68, y las CDR de cadena ligera L1-L3 de las SEQ ID NO:76, 84 y 92.

PDF original: ES-2699244_T3.pdf

USO DE UN ANTICUERPO ANTIPRESENILINA PARA LA PREVENCIÓN Y/O TRATAMIENTO DEL CÁNCER.

(07/02/2019). Solicitante/s: ALZHEIMUR 2012 S.L. Inventor/es: GONZALEZ SARMIENTO,Rogelio, RODRIGUEZ MANOTAS,Miguel, FERNANDEZ MATEOS,Javier, GALLAR RUIZ,Juan Carlos, FLORENCIANO GOMEZ,David.

La presente invención se refiere a un anticuerpo o un fragmento del mismo, específico contra la presenilina, y más concretamente contra el bucle luminal de la presenilina, para su uso en la prevención y/o tratamiento del cáncer, mediante la administración de una cantidad terapéuticamente efectiva de dicho anticuerpo o de un fragmento del mismo, o de una composición farmacéutica que lo comprenda, a un sujeto que padece cáncer.

Receptores de antígenos quiméricos M971.

(06/02/2019). Solicitante/s: The United States Of America, As Represented By The Secretary, Department Of Health And Human Services . Inventor/es: PASTAN, IRA, H., DIMITROV,DIMITER S, ORENTAS,RIMAS J, MACKALL,CRYSTAL L.

Un receptor de antígeno quimérico (CAR) que se une específicamente a CD22, comprendiendo el CAR: un dominio de unión a antígeno que comprende una CDR1 de cadena pesada que comprende la SEQ ID NO: 1, una CDR2 de cadena pesada que comprende la SEQ ID NO: 2, una CDR3 de cadena pesada que comprende la SEQ ID NO: 3, una CDR1 de cadena ligera que comprende la SEQ ID NO: 4, una CDR2 de cadena ligera que comprende la SEQ ID NO: 5, una CDR3 de cadena ligera que comprende la SEQ ID NO: 6, un dominio transmembrana y un dominio de señalización de linfocitos T intracelular.

PDF original: ES-2718903_T3.pdf

Anticuerpos anti-BAG3 para uso terapéutico.

(30/01/2019). Solicitante/s: BIOUNIVERSA S.r.l. Inventor/es: TURCO,Maria Caterina.

Anticuerpo anti-BAG3 para uso en el tratamiento de tumor pancreático, caracterizado en que la proteína BAG3 es extracelular.

PDF original: ES-2721935_T3.pdf

Proteínas que comprenden regiones de unión, regiones efectoras de la subunidad A de toxina Shiga y motivos señal de localización de retículo endoplasmático carboxi terminal.

(30/01/2019) Proteína que comprende a) una región de unión capaz de unirse específicamente a al menos una biomolécula diana extracelular, b) una región efectora de la subunidad A de la toxina Shiga que comprende un polipéptido capaz de mostrar al menos una función de la toxina Shiga, en la que el polipéptido comprende o consiste en una secuencia que es al menos 85% idéntica a una secuencia seleccionada de entre: (i) los aminoácidos 75 a 251 de SEQ ID NO: 1, SEQ ID NO: 2, o SEQ ID NO: 3; (ii) los aminoácidos 1 a 241 de SEQ ID NO: 1, SEQ ID NO: 2, o SEQ ID NO: 3; (iii) los aminoácidos 1 a 251 de SEQ ID NO: 1, SEQ ID NO: 2,…

Procedimientos para bloquear el crecimiento de células madre cancerosas.

(25/01/2019) Un procedimiento in vitro para bloquear el crecimiento de células madre cancerosas, que comprende administrar una cantidad eficaz de un anticuerpo monoclonal que se une a un polipéptido del receptor 49 acoplado de proteínas G (GPR49) con una Kd menor de 10x10-9 M para una célula madre cancerosa, en el que el polipéptido del GPR49 comprende la secuencia de aminoácidos de la SEQ ID NO: 1 y la cantidad eficaz es suficiente para bloquear el crecimiento de células madre cancerosas, en el que el crecimiento de células madre cancerosas se mide en un ensayo de esferas tumorales como un crecimiento de una célula madre de cáncer de colon primario en condiciones in vitro libres de…

Anticuerpos humanos contra PD-L1.

(23/01/2019). Solicitante/s: REGENERON PHARMACEUTICALS, INC.. Inventor/es: PAPADOPOULOS, NICHOLAS, J., THURSTON, GAVIN, MURPHY, ANDREW, J., IOFFE,ELLA, BUROVA,ELENA.

Un anticuerpo aislado o fragmento de unión al antígeno del mismo que se une a la proteína ligando de muerte programada 1 (PD-L1) humana, en el que el anticuerpo aislado o fragmento de unión al antígeno del mismo comprende tres regiones determinantes de la complementariedad (CDR) de una región variable de la cadena pesada (HCVR) que tiene una secuencia de aminoácidos de la SEQ ID NO: 82, y tres CDR de una región variable de la cadena ligera (LCVR) que tiene una secuencia de aminoácidos de la SEQ ID NO: 90.

PDF original: ES-2711450_T3.pdf

Anticuerpos monoclonales para el tratamiento de cáncer.

(16/01/2019). Solicitante/s: ASTELLAS PHARMA INC.. Inventor/es: TURECI, OZLEM, SAHIN, UGUR, KOSLOWSKI,MICHAEL, MITNACHT-KRAUS,RITA.

Un anticuerpo seleccionado del grupo que consiste en: (i) un anticuerpo producido o que puede obtenerse a partir de un clon depositado bajo el núm. de acceso DSM ACC3040 (63-1A-2), (ii) un anticuerpo que es una forma quimerizada o humanizada del anticuerpo en (i), y (iii) un anticuerpo que comprende la porción de unión al antígeno o el sitio de unión al antígeno del anticuerpo en (i).

PDF original: ES-2696518_T3.pdf

Anticuerpos anti CD84, composiciones que comprenden los mismos y usos de los mismos.

(15/01/2019). Solicitante/s: YEDA RESEARCH AND DEVELOPMENT CO. LTD.. Inventor/es: SHACHAR,IDIT, BINSKY,INBAL, MAROM,AYELET.

Un anticuerpo aislado que comprende un dominio de reconocimiento de antígeno que comprende: regiones determinantes de complementariedad como se expone en las SEQ ID NO: 1, NO: 2, NO: 3, NO: 4, NO: 5 y NO: 6 (B4), o regiones determinantes de complementariedad como se expone en las SEQ ID NO: 7, NO: 8, NO: 9, NO: 10, NO: 11 y NO: 12 (B1), en donde el anticuerpo se une específicamente a CD84.

PDF original: ES-2696348_T3.pdf

Anticuerpos contra endoplasmina y su uso.

(11/01/2019). Solicitante/s: UNIVERSITY OF PITTSBURGH OF THE COMMONWEALTH SYSTEM OF HIGHER EDUCATION. Inventor/es: FERRONE, SOLDANO, WANG,XINHUI, CONRADS,THOMAS P, FAVOINO,ELVIRA, HOOD,BRIAN.

Una molécula quimérica aislada comprendiendo un anticuerpo monoclonal humano, o un fragmento de unión al antígeno del mismo, que comprende un dominio variable de la cadena pesada, y un dominio variable de cadena ligera, donde el dominio variable dE cadena pesada comprende los aminoácidos 26-33 de SEC ID Nº: 1 (CDR 1), los aminoácidos 51-58 de SEC ID Nº: 1 (CDR2), los aminoácidos 97-103 de SEC ID Nº: 1 (CDR3), y donde el dominio variable de cadena ligera comprende los aminoácidos 27-32 de SEC ID Nº: 2 (CDR1), los aminoácidos 50-52 de SEC ID Nº: 2 (CDR2), los aminoácidos 89-97 de SEC ID Nº: 2 (CDR3), donde el anticuerpo monoclonal humano o el fragmento de unión al antígeno se une específicamente a la endoplasmina humana, y donde el anticuerpo monoclonal humano o el fragmento de unión al antígeno del mismo va unido a una molécula efectora, donde la molécula efectora es un interferón.

PDF original: ES-2695899_T3.pdf

Receptores de antígenos quiméricos anti-variante III de receptor de factor de crecimiento epidérmico y uso de los mismos para el tratamiento de cáncer.

(11/01/2019). Solicitante/s: The United States Of America, As Represented By The Secretary, Department Of Health And Human Services . Inventor/es: MORGAN, RICHARD, A., ROSENBERG, STEVEN, A..

Receptor de antígeno quimérico (CAR) que comprende un dominio de unión a antígeno contra la variante III de receptor de factor de crecimiento epidérmico, un dominio bisagra extracelular, un dominio transmembrana y un dominio de señalización de células T intracelular, en el que el dominio de unión a antígeno comprende una región variable de cadena ligera que comprende SEQ ID NO: 1 y una región variable de cadena pesada que comprende SEQ ID NO: 2, preferiblemente en el que el dominio de unión a antígeno comprende: (a) un péptido ligador que comprende SEQ ID NO: 3; (b) una secuencia líder que comprende SEQ ID NO: 4; y/o (c) SEQ ID NO: 5.

PDF original: ES-2696000_T3.pdf

Compuestos conjugados que comprenden anticuerpos modificados por ingeniería genética con cisteína.

(09/01/2019). Solicitante/s: MEDIMMUNE, LLC. Inventor/es: GAO, CHANGSHOU, RAINEY,GODFREY, GAO,CUIHUA.

Un compuesto conjugado que comprende un anticuerpo o una proteína de fusión Fc modificados por ingeniería genética con cisteína y al menos una unidad estructural heteróloga, en el que: (i) el dominio Fc del anticuerpo o la proteína de fusión Fc comprende una inserción de aminoácido cisteína entre las posiciones 239 y 240, en el que la numeración de la posición del aminoácido es según el índice de la EU según lo establecido en Kabat; y (ii) en el que al menos una unidad estructural heteróloga está conjugada con el aminoácido cisteína insertado entre las posiciones 239 y 240.

PDF original: ES-2719584_T3.pdf

Polipéptidos y polinucleótidos, y usos de los mismos como una diana farmacológica para producir fármacos y agentes biológicos.

(09/01/2019). Solicitante/s: COMPUGEN LTD. Inventor/es: LEVY, OFER, BUBIS,MARINA, LEVINE,ZURIT, ROSENBERG,AVI, ROTMAN,GALIT, NOVIK,AMIT, TOPORIK,AMIR, KINAR,YARON, NEMZER,SERGEY, KOIFMAN,CYNTHIA, BEIMAN,MERAV, DASSA,LIAT, WALACH,SHIRA, MONTIA,EVE, SAMEACH-GREENWALD,SHIRLEY, PERGAM,TANIA, MILO,DALIT, COHEN-DAYAG,ANAT.

Un anticuerpo monoclonal o policlonal o un fragmento de unión a antígeno del mismo que se une al ectodominio de C1ORF32 o porciones o variantes del mismo y bloquea la interacción de C1 ORF32 con su contra-receptor, en el que el ectodominio se selecciona de los polipéptidos de SEQ ID NO 147, 148 y 299 y la variante del mismo posee al menos un 80 % de identidad de secuencia con la misma para su uso en terapia.

PDF original: ES-2719728_T3.pdf

Análogos de tubulisina y métodos de fabricación y uso.

(09/01/2019) Un analogo de tubulisina que tiene una estructura representada por la formula (I)**Fórmula** en donde R1 es**Fórmula** en donde R1a es H, alquilo C1-C5, alquenilo C2-C5, alquinilo C2-C5, CO(alquilo C1-C5), CO(alquenilo C2-C5) o CO(alquinilo C2-C5); cada R1b es independientemente H o alquilo C1-3; R1c es H, Me o CH(Me)2; y n es 0, 1 o 2; R2 es H, alquilo C1-C10 sin sustituir o sustituido, alquenilo C2-C10 sin sustituir o sustituido, alquinilo C2-C10 sin sustituir o sustituido, arilo sin sustituir o sustituido, heteroarilo sin sustituir o sustituido, (CH2)1-2(alquilo C1-C10) sin sustituir o sustituido, (CH2)1-2O(alquenilo C2-C10) sin sustituir o sustituido, (CH2)1-2O(alquinilo C2-C10) sin sustituir…

Dominio de unión específico entre especies.

(28/12/2018). Solicitante/s: Amgen Research (Munich) GmbH . Inventor/es: KUFER, PETER, RAUM, TOBIAS, HOFFMANN,PATRICK, KLINGER,MATTHIAS, RAU,DORIS, MANGOLD,SUSANNE, KISCHEL,ROMAN, LUTTERBÜSE,RALF.

Un polipéptido que comprende un dominio de unión, que es un anticuerpo capaz de unirse a un epítopo de la cadena CD3ε humana y de Callithrix jacchus, Saguinus oedipus o Saimiri sciureus, en donde el epítopo es parte de una secuencia de aminoácidos comprendida en el grupo que consiste en SEQ ID NOs:2, 4, 6, u 8 y comprende al menos la secuencia de aminoácidos Gln-Asp-Gly-Asn-Glu, en donde el primer dominio de unión comprende una región VL que comprende CDR-L1 GSSTGAVTSGNYPN (SEQ ID NO:153), CDR-L2 GTKFLAP (SEQ ID NO:154) y CDR-L3 VLWYSNRWV (SEQ ID NO:155) y una región VH que comprende CDR-H 1 KYAMN (SEQ ID NO:174), CDR-H2 RIRSKYNNYATYYADSVKD (SEQ ID NO:175) y CDR-H3 HGNFGNSYISYWAY (SEQ ID NO:176), y en donde el polipéptido comprende además un segundo dominio de unión capaz de unirse a un antígeno de la superficie celular que es CD33.

PDF original: ES-2695047_T3.pdf

Polipéptidos de interleucina-2 mutantes.

(21/12/2018) Un inmunoconjugado que comprende un polipéptido de IL-2 mutante y un resto de unión a antígeno, en el que dicho polipéptido de IL-2 mutante comprende la secuencia de SEQ ID NO: 19; y en el que dicho resto de unión a antígeno es una molécula de inmunoglobulina de subclase IgG1 específica para la proteína de activación de fibroblastos (FAP), que comprende (i) la secuencia de la región variable de la cadena pesada de SEQ ID NO: 41 y la secuencia de la región variable de la cadena ligera de SEQ ID NO: 39; (ii) la secuencia de la región variable de la cadena pesada de SEQ ID NO: 51 y la secuencia de la región variable de la cadena ligera de SEQ ID NO: 49; (iii) la secuencia de la región variable de la cadena pesada de SEQ ID NO: 111 y la secuencia de la región variable de la cadena…

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(12/12/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Anticuerpo apto para unirse a cMet, o uno de sus fragmentos divalentes de unión a antígeno caracterizado por que el anticuerpo comprende una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 4, 5 y 6; y una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 13, 11 y 14.

PDF original: ES-2693542_T3.pdf

Agente terapéutico que induce citotoxicidad.

(10/12/2018) Un complejo polipeptídico que comprende: un dominio de unión al antígeno canceroso; uno cualquiera de los dominios Fc de las SEQ ID NOs: 23, 24, 25 y 26 en el que se muta un aminoácido(s) que forma(n) el dominio Fc, en donde el mutante del dominio Fc ha reducido la actividad de unión al receptor Fcγ por dicha mutación en comparación con el complejo polipeptídico de control que comprende el dominio Fc del mismo isotipo seleccionado de SEQ ID NOs: 23, 24, 25 y 26, y en donde el mutante del dominio Fc ha reducido la actividad de unión a FcγRI, FcγRIIA, FcγRIIB, FcγRIIIA, y/o FcγRIIIB; y un dominio de unión a CD3, en donde el dominio de unión a antígeno y el dominio de unión a CD3 son cada uno un Fab monovalente, y en donde (i) el fragmento Fv de cadena pesada…

Agente farmacéutico para el tratamiento y/o la prevención de cáncer.

(28/11/2018). Solicitante/s: TORAY INDUSTRIES, INC.. Inventor/es: OKANO, FUMIYOSHI, IDO,TAKAYOSHI, NARITA,YOSHINORI.

Un medicamento para su uso en un método para el tratamiento y/o la prevención de un cáncer, que comprende un anticuerpo que tiene reactividad inmunológica con una proteína CAPRIN-1 que tiene la secuencia de aminoácidos de una cualquiera de las secuencias numeradas pares SEQ ID NO: 2 a 30 y uno o dos o más tipos de agente antitumoral, en donde el anticuerpo y el agente antitumoral o agentes antitumorales se combinan juntos o por separado y en donde el anticuerpo se une específicamente a la región extracelular de una proteína CAPRIN-1 que existe en la superficie de una célula cancerosa y tiene actividad citotóxica celular.

PDF original: ES-2691738_T3.pdf

Composiciones que contienen y métodos que implican derivados de dolastatina enlazados con aminoácidos no naturales y usos de los mismos.

(23/11/2018) Un compuesto que tiene: **Fórmula** en donde: Z tiene la estructura de: **Fórmula** R5 es H, COR8, C1-C6 alquilo o tiazol; R8 es OH o -NH-(alquileno-O)n-NH2; R6 es OH o H; Ar es fenilo o piridina; R7 es C1-C6 alquilo o hidrógeno; Y se selecciona del grupo que consiste en una hidroxilamina; L es un enlazador seleccionado del grupo que consiste en -alquileno-, -alquileno-C(O)-, -(alquileno-O)n-alquileno-, - (alquileno-O)n-alquileno-C(O)-, -(alquileno-O)n- (CH2)n'-NHC(O)-(CH2)n"-C(Me)2-S-S-(CH2)n'"-NHC(O)-(alquileno-O)n''''- alquileno-, -(alquileno-O)n-alquileno-W-, -alquileno-C(O)-W-, -(alquileno-O)n-alquileno-U-alquileno-C(O)- y - (alquileno-O)n-alquileno-U-alquileno-; W tiene la estructura de: **Fórmula** U tiene la estructura de: **Fórmula** o L está ausente, Y es metilo, R5 es COR8, y R8 es -NH-(alquileno-O)n-NH2;…

La terapia anti-EMP2 reduce las células madre cancerosas.

(13/11/2018) Un anticuerpo para uso en la reducción de células madre cancerosas que expresan EMP2 en un paciente que tiene cáncer y que se ha identificado previamente que comprende células madre cancerosas que expresan EMP2 y uno o más marcadores seleccionados del grupo que consiste en CD44, CD 133 ABCG2 y ALDH, en donde: a) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos: MAQVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAVYYCARDRRGRKSAGIDYWGQGTLVTVSS, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula** b) el anticuerpo comprende una cadena…

Productos génicos de expresión diferencial en tumores y su uso.

(31/10/2018) Composición farmacéutica para su uso en un método para el tratamiento de una enfermedad de cáncer que se distingue por la expresión de un antígeno asociado a un tumor, que comprende uno o varios componentes seleccionados del grupo formado por: (i) un antígeno asociado a un tumor o una parte del mismo, (ii) un ácido nucleico que codifica un antígeno asociado a un tumor o una parte del mismo, (iii) un anticuerpo que se une a un antígeno asociado a un tumor, (iv) un ácido nucleico no codificante que hibrida de forma específica con un ácido nucleico que codifica un antígeno asociado a un tumor y (v) una célula huésped que…

Anticuerpo monoclonal anti CD146.

(19/10/2018). Solicitante/s: Oncoinvent AS. Inventor/es: LARSEN,ROY HARTVIG, BØNSDORFF,TINA BJØRNLUND.

Una molécula de anticuerpo que se une a CD146 humano y que es a) un anticuerpo monoclonal que está definido por i) una cadena pesada variable que comprende la secuencia de aminoácidos mostrada en la SEQ ID NO: 3; y ii) una cadena ligera variable que comprende la secuencia de aminoácidos mostrada en la SEQ ID NO: 4, o b) un anticuerpo monoclonal que comparte al menos el 90 % de identidad de secuencia con los anticuerpos definidos en a).

PDF original: ES-2686692_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · 9 · 10 · 11 · 12 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015