CIP 2015 : C07K 14/605 : Glucagones.

CIP2015CC07C07KC07K 14/00C07K 14/605[3] › Glucagones.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C07 QUIMICA ORGANICA.

C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.

C07K 14/605 · · · Glucagones.

CIP2015: Invenciones publicadas en esta sección.

Agonistas del receptor de glucagón.

(24/06/2020). Solicitante/s: ELI LILLY AND COMPANY. Inventor/es: ALSINA-FERNANDEZ,JORGE, COSKUN,TAMER.

Un compuesto agonista del receptor de glucagón que comprende la fórmula: YX1QGTFX2SDYSKYLDX3KKAX4EFVX5WLLEX6X7 en la que X1 es Aib; X2 es T o L; X3 es Aib; X4 es K que se modifica químicamente mediante conjugación con el grupo épsilon-amino de la cadena lateral K con ([2-(2-Amino-etoxi)-etoxi]-acetil)2-(γGlu)a-CO-(CH2)b-CO2H, en la que a es 1 o 2 y b es 14 a 24; X5 es E o A; X6 es T o E; X7 está ausente o es un péptido seleccionado del grupo que consiste en GPSSGAPPPS y GPSSG; y el aminoácido C-terminal está amidado como una amida primaria C-terminal (SEQ ID NO: 5); o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2809548_T3.pdf

Profármacos de GLP-1.

(17/06/2020). Solicitante/s: NOVO NORDISK A/S. Inventor/es: NORRILD,JENS CHRISTIAN.

Un compuesto de GLP-1 de la fórmula general I: R1 -(NHXaa1)-Xaa2-(OHis)-(péptido GLP-1) (Fórmula I) en donde el péptido GLP-1 es GLP-1 (SEQ ID NO: 1) o un análogo de este con un máximo de seis cambios de aminoácidos en comparación con GLP-1 (SEQ ID NO: 1); R1 es alquilo lineal o ramificado que tiene de uno a seis átomos de carbono; (NHXaa1) es un aminoácido; Xaa2 es un aminoácido; (OHis) es un residuo de histidina modificado en el que el grupo alfa-amino se reemplaza por un grupo hidroxilo; el enlace entre Xaa2 y (OHis) es un enlace éster; y el enlace entre (OHis) y (péptido GLP-1) es un enlace amida; o una sal, amida, o éster farmacéuticamente aceptable de este, en donde, (OHis) es un radical del ácido imidazol-láctico de la fórmula del Quím. 1: **(Ver fórmula)**.

PDF original: ES-2810153_T3.pdf

Método para preparar semaglutida.

(13/05/2020) Método de preparación de semaglutida, que comprende las etapas de: etapa 1: acoplar Gly a una resina mediante síntesis en fase sólida para obtener Gly-resina; y etapa 2: acoplar sucesivamente la Gly-resina preparada en la etapa 1 a un aminoácido según la secuencia de semaglutida mediante acoplamiento secuencial; escisión y purificación; en el que se usa Fmoc-Lys(Alloc)-OH como material de partida de Lys26; se sintetiza H-His7 usando Boc-His(Trt)-OH o Boc-His(Boc)-OH.DCHA como material de partida; y la cadena lateral de Lys26 se prepara mediante síntesis fragmentaria, y se prepara un fragmento completamente protegido de Fmoc-PEG-PEG-g-Glu-ácido…

Coagonistas estables del receptor de GLP-1/glucagón basados en GLP-1.

(06/05/2020). Solicitante/s: NOVO NORDISK A/S. Inventor/es: KRUSE, THOMAS, TH GERSEN, HENNING, SPETZLER,JANE, REEDTZ-RUNGE,STEFFEN, SENSFUSS,ULRICH, LAU,JESPER F, WENZEL TORNØE,CHRISTIAN.

Un derivado de GLP-1 caracterizado por tener la fórmula: amida de Nε34-[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxi-4- [[(4S)-4-carboxi-4-(17- carboxiheptadecanoilamino)butanoil]amino]butanoil]amino]etoxi]etoxi]acetil]amino]etoxi]etoxi]acetil]- [Imp7,Aib8,His9,Lys18,Glu22,Arg26,Leu33,Thr35]-GLP-1- -péptido **(Ver fórmula)**.

PDF original: ES-2805326_T3.pdf

Una composición para el tratamiento de la diabetes que comprende un análogo de oxintomodulina.

(11/03/2020). Solicitante/s: HANMI PHARM. CO., LTD.. Inventor/es: KWON, SE CHANG, JUNG, SUNG YOUB, KIM,DAE-JIN, KIM,JIN SUN, LEE,SANG HYUN.

Una composición para su uso en la prevención o el tratamiento de la diabetes, la composición comprende un conjugado de análogo de oxintomodulina como un ingrediente activo en donde el conjugado de análogo de oxintomodulina comprende un análogo de oxintomodulina que comprende la secuencia de aminoácidos de las SEQ ID NO: 24, 25 o 26; una región Fc de inmunoglobulina; y un polímero no peptidílico, en donde el polímero no peptidílico une el análogo de oxintomodulina a la región Fc de inmunoglobulina a través de un enlace covalente.

PDF original: ES-2802099_T3.pdf

Modificador de exenatida y uso del mismo.

(12/02/2020). Solicitante/s: BrightGene Bio-Medical Technology Co., Ltd. Inventor/es: YUAN,FANG, YUAN,JIANDONG, HUANG,YANGQING, SONG,YUNSONG.

Un modificador de exenatida o sales farmacéuticamente aceptables del mismo que tienen actividad del agonista del receptor de GLP-1, como se muestra en la fórmula (I): (Ex-4)-L-Y (I) en donde, Ex-4 es Exendina-4; L es **(Ver fórmula)** para conectar Ex-4 con Y; L' es una cadena hidrofílica que contiene un grupo éter; Y es una cadena alifática con un grupo carboxilo terminal, en donde el modificador de exenatida es: **(Ver fórmula)** k es cualquier número entero entre 6-20.

PDF original: ES-2775185_T3.pdf

Derivados de GLP-1 doble-acilados.

(04/12/2019) Un derivado de un análogo de GLP-1, cuyo análogo comprende un primer residuo de K en una posición correspondiente a la posición 26 de GLP-1 (SEQ ID NO: 1), un segundo residuo de K en una posición correspondiente a la posición 37 de GLP-1 (SEQ ID NO: 1), y un máximo de ocho cambios de aminoácidos en comparación con GLP-1 , cuyo derivado comprende dos porciones de prolongación unidas a dicho primer y segundo residuo de K, respectivamente, mediante un conector, en donde la porción de prolongación se selecciona del Quím. 2 y el Quím. 1: Quím. 2: HOOC-C6H4-O-(CH2)y-CO-* Quím. 1: HOOC-(CH2)x-CO-*, en donde x es un número entero en el intervalo de 8-16 y "y" es un número entero en el intervalo de 6-13; y el conector comprende…

Análogos de glucagón.

(13/11/2019) Un compuesto que tiene la fórmula: R1-X-Z-R2 en donde R1 es H (es decir, hidrógeno), alquilo C1-4, acetilo, formilo, benzoílo o trifluoroacetilo; R2 es OH o NH2; X es un péptido que tiene la secuencia: H-X2-X3-GTFTSDYSKYL-X15-X16-X17-X18-A-X20-DFI-X24-WLE-X28-A en donde: X2 se selecciona entre Ac3c, Ac4c y Ac5c; X3 se selecciona entre Gln e His; X15 se selecciona entre Asp y Glu; X16 se selecciona entre Glu, Lis y Ψ ; X17 se selecciona entre Lys, Arg y Ψ; X18 se selecciona entre Ala y Arg; X20 se selecciona entre Lys y Ψ ; X24 se selecciona entre Glu, Lys y Ψ ; X28 se selecciona entre Ser, Lys y Ψ ; en donde cada Ψ es un resto seleccionado independiente entre Lys, Arg, Orn y Cys y en donde la cadena lateral de cada resto…

Análogos de glucagón.

(06/11/2019). Solicitante/s: ZEALAND PHARMA A/S. Inventor/es: THOMAS, LEO, RIBER,Ditte, HAMPRECHT,Dieter Wolfgang, RIST,WOLFGANG, TOLBORG,JAKOB LIND, FOSGERAU,KELD, NØRREGARD,PIA, JUST,RASMUS, AUGUSTIN,ROBERT.

Un compuesto que tiene la fórmula: R1-X-Z-R2 En la que R1 es H, alquilo C1-4, acetilo, formilo, benzoilo o trifluoroacetilo; R2 es OH o NH2; X es un péptido que consiste en la secuencia: HSQGTFTSDYSKYLDSKAAEDFVEWLLRA (SEQ ID Nº: 7) Z no está presente o es una secuencia de 1-20 unidades de aminoácidos independientemente seleccionados del grupo que consiste en Ala, Leu, Ser, Thr, Tyr, Cys, Glu, Lys, Arg, Dbu, Dpr y Orn; y en la que una o más de las cadenas laterales de aminoácidos del péptido X o Z están conjugadas opcionalmente a un sustituyente lipófilo; o una sal o solvato farmacéuticamente aceptable del mismo.

PDF original: ES-2768601_T3.pdf

Análogo de glucagón acilado.

(02/10/2019). Solicitante/s: ZEALAND PHARMA A/S. Inventor/es: THOMAS, LEO, RIBER,Ditte, HAMPRECHT,Dieter Wolfgang, TOLBORG,JAKOB LIND.

Un compuesto que tiene la fórmula: R1-H-Aib-QGTFTSDYSKYLDERAAKDFIEWLE-K([17-Carboxi-heptadecanoil]-isoGlu-GSGSGG)-A-R2 en la que R1 es H (hidrógeno), alquilo C1-4, acetilo, formilo, benzoílo o trifluoroacetilo y R2 es OH o NH2; o una sal o un solvato farmacéuticamente aceptables del mismo.

PDF original: ES-2763329_T3.pdf

GLP y polipéptido fusionado a Fc híbrido de inmunoglobulina y su uso.

(04/09/2019). Solicitante/s: Genexine, Inc. Inventor/es: SUNG, YOUNG CHUL, YANG,SE HWAN, BYUN,MI SUN, YANG,SANG IN, SHIN,EUN JU.

Un polipéptido de fusión que comprende (a) péptido tipo glucagon (GLP) o un análogo del mismo, y (b) un polipéptido de Fc de inmunoglobulina, en el que el polipéptido de Fc de inmunoglobulina comprende (i) una región de bisagra de IgD aislada que consiste en una secuencia de aminoácidos de 35 a 49 residuos de aminoácidos consecutivos del extremo C-terminal de la SEQ ID NO: 25; y (ii) un dominio CH2 y un dominio CH3 del polipéptido de Fc de inmunoglobulina.

PDF original: ES-2757812_T3.pdf

Compuestos coagonistas de GIP y GLP-1.

(14/08/2019). Solicitante/s: ELI LILLY AND COMPANY. Inventor/es: CUMMINS,ROBERT,CHADWICK, ALSINA-FERNANDEZ,JORGE, COSKUN,TAMER, BOKVIST,BENGT KRISTER.

Un compuesto de Fórmula: YX1EGTFTSDYSIX2LDKIAQKAX3VQWLIAGGPSSGAPPPS; en la que X1 es Aib; X2 es Aib; K en la posición 20 se modifica químicamente a través de la conjugación al grupo épsilon-amino de la cadena lateral K con ([2-(2-Amino-etoxi)-etoxi]-acetil)2-(γGlu)a-CO-(CH2)b-CO2H en la que a es 1 a 2 y b es 10 a 20; X3 es Phe o 1-NaI; y el aminoácido del extremo terminal C está opcionalmente amidado como una amida primaria del extremo terminal C (SEQ ID NO:11), o una de sus sales aceptables para uso farmacéutico.

PDF original: ES-2747928_T3.pdf

Agonistas del receptor de glucagón.

(07/08/2019). Solicitante/s: Elanco US Inc. Inventor/es: ALSINA-FERNANDEZ,JORGE, COSKUN,TAMER.

Un compuesto agonista del receptor de glucagón que comprende la fórmula: YX1QGTFX2SDYSKYLDX3KKAX4EFVX5WLLEX6X7 en la que X1 es Aib; X2 es T; X3 es Aib; X4 es K que se modifica químicamente mediante conjugación con el grupo épsilon-amino de la cadena lateral K con ([2-(2-Amino-etoxi)-etoxi]-acetil)2-(γGlu)a-CO-(CH2)b-CO2H, en la que a es 1 y b es 18; Xes A; X6 es E; y X7 está ausente; (SEQ ID NO: 12); o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2747908_T3.pdf

Nuevos análogos de glucagón.

(07/08/2019). Solicitante/s: NOVO NORDISK A/S. Inventor/es: KRUSE, THOMAS, TH GERSEN, HENNING, NIELSEN,PETER KRESTEN, SENSFUSS,ULRICH, LAU,JESPER F.

Un péptido de glucagón que comprende: • la SEQ ID 1, en donde X24 es Lys y en donde al menos una de las siguientes sustituciones está presentes: X15 es Glu o X16 es Ala, Ile, Phe, Arg, Thr, Val, Leu, Glu, Trp o Tyr, y hasta seis sustituciones de aminoácidos adicionales están presentes en dicho péptido de glucagón y • un sustituyente que comprende tres o más restos cargados negativamente, en donde uno de dichos restos cargados negativamente es distal de un resto lipofílico y donde el sustituyente se une al nitrógeno de la cadena lateral de Lys en la posición 24, o una sal, éster, amida o ácido farmacéuticamente aceptable de este.

PDF original: ES-2767705_T3.pdf

Formulación líquida de conjugado de proteínas que comprende la oxintomodulina y un fragmento de inmunoglobulina.

(10/07/2019). Solicitante/s: HANMI PHARM. CO., LTD.. Inventor/es: KWON, SE CHANG, BAE, SUNG MIN, JANG,MYUNG HYUN, KIM,HYUN UK, LIM,HYUNG KYU, KIM,SANG YUN.

Una formulación líquida de un conjugado derivado de oxintomodulina de larga duración, que comprende una cantidad farmacológicamente activa de un conjugado derivado de oxintomodulina de larga duración en la que el conjugado derivado de oxintomodulina comprende un derivado de oxintomodulina, que es un péptido fisiológicamente activo, que comprende la secuencia de aminoácidos de una cualquiera de las SEQ ID NO: 24, 25 o 26; una región Fc de inmunoglobulina; y un polímero no peptidílico, en la que el polímero no peptidílico une covalentemente el derivado de oxintomodulina y la región Fc de inmunoglobulina, y un estabilizador sin albúmina, en la que el estabilizador contiene un tampón que tiene un pH que varía de 4,8 a 6,0, uno o más alcoholes de azúcar seleccionados de manitol y sorbitol y polisorbato 20.

PDF original: ES-2748158_T3.pdf

Coagonistas de receptores de GLP-1/glucagón prolongados y estables para uso médico.

(12/06/2019) Un derivado de glucagón que comprende la secuencia de aminoácidos de Fórmula I (que corresponde a la SEQ ID NO:4 y la SEQ ID NO:5): His-X2-X3-Gly-Thr-Phe-Thr-Ser-Asp-X10-Ser-X12-Tyr-Leu-X15-X16-X17-X18-Ala-X20-X21-Phe-Val-X24-Trp-Leu-X27- X28-X29-X30 [I], en donde, X2 representa Aib, Acb o Acpr; X3 representa Gln o His; X10 representa Leu; X12 representa Lys o Arg; X15 representa Asp o Glu; X16 representa Ser, Ala, Leu, Thr, Glu, Aib, Ile, Val o Lys; X17 representa Arg o Lys; X18 representa Arg, Ala o Lys; X20 representa Gln, Arg, Glu, Aib o Lys; X21 representa Asp, Glu, Ser, o Lys; X24 representa Gln, Ala, Arg, Glu, Aib o Lys; X27 representa…

Derivados de GLP-1 y sus usos.

(12/06/2019) Un derivado de un análogo de GLP-1 de la Fórmula General I: Xaa7-Xaa8-Glu-Gly-Thr-Xaa12-Thr-Ser-Asp-Xaa16-Ser-Xaa18-Xaa19-Xaa20-Glu-Xaa22-Xaa23-Ala-Xaa25-Xaa26- Xaa27-Phe-Ile-Xaa30-Xaa31-Leu-Xaa33-Xaa34-Xaa35-Xaa36-Xaa37-Xaa38, en donde Xaa7 es L-histidina o deamino-histidina; Xaa8 es Aib; Xaa12 es Phe; Xaa16 es Val; Xaa18 es Ser; Xaa19 es Tyr; Xaa20 es Leu; Xaa22 es Glu; Xaa23 es Gln; Xaa25 es Ala; Xaa26 es Arg; Xaa27 es Glu; Xaa30 es Ala o Glu; Xaa31 es Trp; Xaa33 es Val; Xaa34 es Arg o Lys; Xaa35 es Gly o Lys; Xaa36 es Arg o Lys; Xaa37 es Pro o Lys; Xaa38 es Lys o está ausente, en donde al menos uno de Xaa34, Xaa35, Xaa36, Xaa37, y Xaa38 es Lys; y en…

Compuestos de glp-1 acilados doblemente.

(12/06/2019) Un derivado de un péptido GLP-1, cuyo péptido se incorpora en el derivado y comprende un primer residuo de Lys en una posición que corresponde a la posición 36 de GLP-1 (SEQ ID NO: 1), un segundo residuo de Lys en una posición que corresponde a la posición 37 de GLP-1 (SEQ ID NO: 1), y un máximo de siete cambios de aminoácidos en comparación con GLP-1 (SEQ ID NO: 1), que incluye los dos cambios de aminoácidos en Lys36 y Lys37; cuyo derivado comprende dos prolongadores unidos a dichos primer y segundo residuos de Lys, respectivamente, cada uno a través de un enlazador; en donde el prolongador se selecciona de: Quím. 1: HOOC-C6H4-O-(CH2)y-CO-*,…

Polipéptidos recombinantes extendidos y composiciones que comprenden los mismos.

(10/04/2019). Solicitante/s: Amunix Pharmaceuticals, Inc. Inventor/es: SCHELLENBERGER, VOLKER, STEMMER, WILLEM, WANG,CHIA-WEI, SILVERMAN,JOSHUA, SPINK,BENJAMIN, GEETHING,NATHAN, TO,WAYNE, CLELAND,JEFFREY.

Un polipeptido recombinante extendido (XTEN) aislado que comprende una secuencia no repetitiva que tiene mas de 100 a 3000 restos de aminoacidos en donde al menos el 95 %, o al menos el 96 %, o al menos el 97 %, o al menos el 98 %, o al menos el 99 % a aproximadamente el 100 % de la secuencia consiste en mutliples unidades de dos o mas motivos de secuencia no solapante seleccionados de las secuencias de aminoacidos de la Tabla 1 en donde la secuencia de cualesquiera dos restos de aminoacidos contiguos en un motivo cualquiera no se repite mas de dos veces en el mismo motivo de secuencia.

PDF original: ES-2730800_T3.pdf

Polipéptidos reguladores de glucosa y métodos para su producción y uso.

(22/03/2019) Un acido nucleico aislado que comprende una secuencia de polinucleotido que codifica una proteina de fusion, que comprende un peptido regulador de la glucosa (GP), en donde la secuencia de polinucleotido (i) comprende una secuencia que hibrida en condiciones rigurosas con AE864 de la tabla 9 (SEQ ID NO: 243) o Ex4-AE864 de la tabla 36 (SEQ ID NO: 897) o el complemento de las mismas y tiene al menos un 70 % de identidad de secuencia o un 80 % o un 90 % o un 95 % o un 97 % o un 98 % o un 99 % hasta un 100 % de identidad de secuencia respecto de AE864 de la tabla 9 (SEQ ID NO: 243) o Ex4-AE864 de la tabla 36 (SEQ ID NO: 897) o el complemento de las mismas, y (ii) codifica una proteina de fusion que comprende (a) exendina-4 y que tiene una secuencia de aminoacidos que muestra al…

Conjugado de oligómero de ácido biliar para un nuevo transporte vesicular y uso del mismo.

(20/02/2019). Solicitante/s: ST Pharm Co., Ltd. Inventor/es: KIM, KYUNGJIN, BYUN,YOUNG RO, AHMED,AL-HILAL TASLIM, JEON,OK CHEOL, MOON,HYUN TAE, YUN,YISUK.

Un método para la preparación de un conjugado de macromolécula-oligómero de ácido biliar específico de sitio terminal, que comprende: (a) preparar un oligómero de ácido biliar mediante la oligomerización de dos o más monómeros de ácidos biliares; y (b) conjugar el oligómero de ácido biliar preparado en la etapa (a) con el sitio terminal de una macromolécula; en el que la macromolécula es un polisacárido.

PDF original: ES-2701077_T3.pdf

Preparación semirrecombinante de análogos del GLP-1.

(20/02/2019) Un método para producir un derivado de un análogo del GLP-1 que comprende uno o más aminoácidos no proteinogénicos en la parte N-terminal, dicho método que comprende las etapas de: (i) cultivar una célula huésped que comprende una secuencia de nucleótidos que codifica una molécula precursora de dicho análogo del GLP-1 en condiciones adecuadas para la expresión de dicha molécula precursora; (ii) separar la molécula precursora expresada del caldo de cultivo; (iii) acilar el grupo épsilon amino de un residuo de lisina en la molécula precursora expresada con un agente de acilación, que se activa opcionalmente, para obtener un derivado de la molécula…

Derivados de péptidos similares a GLP-1, y sus usos.

(16/01/2019) Un derivado de GLP-1 seleccionado de lo siguiente: N{Épsilon-27}-[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxi-4-[[4-[(19- carboxinonadecanoilamino)metil]ciclohexanecarbonil]amino]butanoil]amino]etoxi]etoxi]acetil]amino]etoxi]etoxi] acetil]-[Aib8,Glu22,Arg26,Lys27,Arg34]-GLP-1- -peptidil-Gly-Gly-Gly-Ser-N{Épsilon}[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxi-4-[[4-[(19- carboxinonadecanoilamino)metil]ciclohexanecarbonil]amino]butanoil]amino]etoxi]etoxi]acetil]amino]etoxi]etoxi] acetil]Lys, Quím. 21: **Fórmula** N{Épsilon-31}-[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxi-4-[[4-[(19- carboxinonadecanoilamino)metil]ciclohexanecarbonil]amino]butanoil]amino]etoxi]etoxi]acetil]amino]etoxi]etoxi] acetil]-[Aib8,Glu22,Arg26,Lys31,Arg34]-GLP-1- -peptidil-Gly-Gly-Gly-Ser-N{Épsilon}[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxi-4-[[4-[(19-…

Derivados de GLP-1 doblemente acilados.

(09/01/2019) Un derivado de un análogo de GLP-1, dicho análogo comprende un primer residuo K en una posición correspondiente a la posición 27 de GLP-1 (sec. con núm. de ident.: 1); un segundo residuo K en una posición correspondiente a la posición 37 de GLP-1 ; y un máximo de diez cambios de aminoácidos en comparación con GLP-1 ; en donde el primer residuo K se designa K27, y el segundo residuo K se designa K37; dicho derivado comprende dos porciones de prolongación unidas a K27 y K37, respectivamente, por medio de un enlazador, en donde la porción de prolongación se selecciona del Químico 2 y Químico 1: Químico 2: HOOC-C6H4-O-(CH2)y-CO-* Químico 1: HOOC-(CH2)x-CO-*, en donde x es un número entero en el intervalo de 6-16 y "y" es un número entero en el intervalo de 3-17; y el enlazador comprende el Químico 5: …

Nuevos derivados de oxintomodulina y composición farmacéutica para el tratamiento de obesidad que lo comprende.

(30/11/2018). Solicitante/s: Hanmi Science Co., Ltd. . Inventor/es: KWON, SE CHANG, JUNG, SUNG YOUB, PARK,Young,Jin, PARK,YOUNG KYUNG, JANG,MYUNG HYUN, SHEN,LING AI.

Un péptido que comprende una secuencia de aminoácidos de una cualquiera de las SEQ ID NO: 24, 25, o 26.

PDF original: ES-2692187_T3.pdf

Análogos de glucagón acilados.

(06/11/2018) Un compuesto que tiene la fórmula: R1-P1-P2-R2 en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoílo o trifluoroacetilo; R2 es OH o NH2; P1 es un péptido que tiene la secuencia: His-X2-X3-GTFTSDYSKYL-X15-X16-X17-X18-A-X20-DFI-X24-WLE-X28-A en la que: X2 se selecciona entre Aib, Ac3c, Ac4c y Ac5c; X3 se selecciona entre Gln y His; X15 se selecciona entre Asp y Glu; X16 se selecciona entre Glu y ψ ; X17 se selecciona entre Arg y ψ ; X18 se selecciona entre Ala y Arg; X20 se selecciona entre Lys y His; X24 se selecciona entre Glu y ψ ; X28 se selecciona entre Ser y ψ ; y P2 está ausente o es una secuencia de 1-20 unidades de aminoácidos seleccionados independientemente entre el grupo que consiste en Ala, Leu, Ser, Thr, Tyr, Cys, Glu,…

Derivados de exendina-4 como agonistas duales de GLP1/GIP o trigonales de GLP1/GIP/glucagón.

(02/11/2018) Un compuesto peptídico que tiene la fórmula (I): R1-Z-R2 (I) en la que Z es un resto de péptido que tiene la fórmula (II) Tyr-Aib-X3-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-X12-Gln-X14-X15-X16-X17-5 X18-X19-X20-X21-Phe- Ile-Glu-Trp-Leu-Lys-X28-X29-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-X(II) X3 representa Glu, X12 representa un resto de aminoácido seleccionado de Ile y Lys, X14 representa un resto de aminoácido que tiene una cadena lateral con un grupo -NH2, en el que el grupo de cadena lateral -NH2 está funcionalizado por -C(O)-R5, en la que R5 puede ser un resto que comprende hasta 50 o hasta…

Método para preparar exenatida.

(29/10/2018). Solicitante/s: Hybio Pharmaceutical Co., Ltd. Inventor/es: LIU, JIAN, MA,YAPING, YUAN,JIANCHENG, MI,PENGCHENG.

Un método para la preparación de exenatida, que se caracteriza por comprender las siguientes etapas: Etapa 1: se obtiene serina-resina mediante un primer acoplamiento entre serina y la resina; Etapa 2: se obtiene péptido-resina de SEQ ID NO: 1 mediante un segundo acoplamiento de dicha serinaresina secuencialmente con aminoácidos; Etapa 3: se obtiene péptido-resina de SEQ ID NO. 2 mediante un tercer acoplamiento entre la histidina que contiene el grupo protector o una sal de la misma con dicho péptido-resina de SEQ ID NO. 1, y la exenatida por último se obtiene después de corte y purificación; en donde la histidina que contiene grupo protector o una sal de la misma en la etapa 3 tiene la estructura como se muestra en la fórmula IV: Boc-His(Boc)-OH.DCHA Fórmula IV, en donde la etapa 3 comprende obtener exenatida-resina en un solvente en presencia de un agente de acoplamiento y una base orgánica, en donde el agente de acoplamiento es HATU y HOAt.

PDF original: ES-2687795_T3.pdf

Composiciones de péptido-2 similar a glucagón y métodos para producir y usar los mismos.

(26/10/2018). Solicitante/s: Amunix Operating Inc. Inventor/es: SCHELLENBERGER, VOLKER, STEMMER,WILLEM P, WANG,CHIA-WEI, SILVERMAN,JOSHUA, SPINK,BENJAMIN, GEETHING,NATHAN.

Una composición para su uso en el tratamiento de la enteritis en un sujeto mamífero logrando un efecto intestinotrófico, comprendiendo la composición una proteína de fusión que comprende: (i) una secuencia de proteína-2 similar a glucagón (GLP-2) que consiste en la secuencia: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD y (ii) un polipéptido recombinante extendido (XTEN), en donde el XTEN es la secuencia AE864 de la tabla 4; en donde dicha composición muestra un efecto intestinotrófico cuando se administra al sujeto con enteritis que es al menos un 100% o al menos un 120% o al menos un 150% o al menos un 200% del efecto intestinotrófico comparado con el GLP-2 correspondiente no unido a XTEN tras la administración de dicho GLP-2 correspondiente a un sujeto comparable usando una dosis comparable.

PDF original: ES-2687651_T3.pdf

Análogos de péptidos gip.

(15/10/2018) Un péptido seleccionado del grupo que consiste en EGTFISDYSIAMX0aX0bIX1QQDFVNWLLAQX2 (GIP3-30; SEQ ID NO: 74), GTFISDYSIAMX0aX0bIX1QQDFVNWLLAQX2 (GIP4-30; SEQ ID NO: 75), TFISDYSIAMX0aX0bIX1QQDFVNWLLAQX2 (GIP5-30; SEQ ID NO: 76), donde X0a, X0b, X1 y X2 son de forma individual cualquier aminoácido, o una variante funcional de estos que tiene al menos el 75 % de identidad de secuencia con dicho péptido, donde dicha variante es un antagonista del receptor de GIP humano, para el uso en un procedimiento para inhibir o reducir uno o más de i) secreción de glucagón inducida por GIP, ii) secreción de insulina inducida por GIP, iii) secreción de somatostatina inducida por GIP, iv) absorción de glucosa inducida por GIP, v) síntesis de ácidos grasos y/o incorporación de ácidos grasos…

Dipéptido que comprende un aminoácido no proteogénico.

(19/09/2018). Solicitante/s: NOVO NORDISK A/S. Inventor/es: CHRISTENSEN,CASPAR, SEVERINSEN,RUNE, RAUNKJÆR,MICHAEL, NORRILD,JENS CHRISTIAN.

Un método de obtención de un polipéptido o proteína final que comprende uno o más aminoácidos no proteogénicos, en el que el método comprende una etapa de hacer reaccionar un dipéptido con un primer polipéptido o proteína, y dicho dipéptido es de Fórmula 1:**Fórmula** en la que R1 es H o un grupo protector de amino, y R2 es un grupo protector de amino; o R1 es un grupo alquilo extraíble, y R2 es H o un grupo alquilo extraíble; o R1 y R2 forman conjuntamente un anillo; R3 es H, o un catión de amonio secundario, un catión de amonio terciario o un catión metálico que forma una sal con el grupo carboxilato; y R4 está ausente o es una sal de ácido.

PDF original: ES-2682253_T3.pdf

1 · · 3 · 4 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .