Variantes de Fc con unión alterada a FcRn.

Un polipéptido que comprende una variante de Fc de un Fc de IgG humana,

en el que dicha variante de Fc comprende una isoleucina en la posición 259 y una fenilalanina en la posición 308, en el que dicha variante de Fc muestra una unión incrementada a FcRn humano comparada con dicha Fc de IgG humana, y en el que la numeración es según el índice EU en Kabat et al.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2008/077250.

Solicitante: Xencor Inc.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 111 W. Lemon Avenue Monrovia, CA 91016 ESTADOS UNIDOS DE AMERICA.

Inventor/es: KARKI,SHER BAHADUR, CHAMBERLAIN,AARON, DAHIYAT,BASSIL, DESJARLAIS,JOHN RUDOLPH.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/395 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53). › Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.
  • C07K16/08 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra materiales víricos.
  • C07K16/22 C07K 16/00 […] › contra factores de crecimiento.
  • C07K16/28 C07K 16/00 […] › contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.
  • C07K16/32 C07K 16/00 […] › contra productos de traducción de oncogenes.

PDF original: ES-2537202_T3.pdf

 


Fragmento de la descripción:

Variantes de Fe con unión alterada a FcRn

La presente solicitud se refiere a variantes de inmunoglobulina IgG optimizadas, a métodos de ingeniería para su generación, y a su aplicación, particularmente para propósitos terapéuticos.

ANTECEDENTES DE LA INVENCIÓN

Los anticuerpos son proteínas inmunológicas que se unen a un antígeno específico. En la mayor parte de los mamíferos, incluyendo los seres humanos y ratones, los anticuerpos se construyen a partir de cadenas polipeptídicas pesadas y ligeras emparejadas. Cada cadena está compuesta por dominios de inmunoglobulinas (Ig) individuales, y así el término genético inmunoglobulina se usa para dichas proteínas. Cada cadena está compuesta por dos regiones distintas, referidas como las regiones variable y constante. Las regiones variables de la cadena ligera y pesada muestran una diversidad de secuencia significativa entre anticuerpos, y son responsables de la unión al antígeno diana. Las regiones constantes muestran menos diversidad de secuencia, y son responsables de la unión a varias proteínas naturales para incitar eventos bioquímicos importantes. En los seres humanos hay cinco clases diferentes de anticuerpos incluyendo IgA (que incluye las subclases lgA1 e lgA2), IgD, IgE, IgG (que incluye las subclases lgG1, lgG2, lgG3, e lgG4), e IgM. La característica diferencial entre estas clases de anticuerpos es sus regiones constantes, aunque pueden existir diferencias sutiles en la región V. La Figura 1 muestra un anticuerpo lgG1, usado aquí como un ejemplo para describir las características estructurales generales de las inmunoglobulinas. Los anticuerpos IgG son proteínas tetraméricas compuestas por dos cadenas pesadas y dos cadenas ligeras. La cadena pesada de IgG está compuesta por cuatro dominios de inmunoglobulina unidos desde el extremo N al C en el orden VH-CH1-CH2-CH3, en referencia al dominio variable de la cadena pesada, dominio constante 1 de cadena pesada, dominio constante 2 de cadena pesada, y dominio constante 3 de cadena pesada respectivamente (también referido como VH-Cy1-Cy2-Cy3, en referencia al dominio variable de cadena pesada, dominio constante gamma 1, dominio constante gamma 2, y dominio constante gamma 3 respectivamente). La cadena ligera de IgG está compuesta por dos dominios de inmunoglobulina unidos desde el extremo N al C en el orden VL-CL, en referencia al dominio variable de cadena ligera y el dominio constante de cadena ligera respectivamente.

La región variable de un anticuerpo contiene los determinantes de unión a antígeno de la molécula, y así determina la especificidad de un anticuerpo para su antígeno diana. La región variable se denomina así porque es la más distinta en secuencia de los demás anticuerpos en la misma clase. La mayor parte de la variabilidad de secuencia ocurre en las regiones determinantes de la complementariedad (CDR). Hay 6 CDR en total, tres por cada cadena pesada y ligera, designadas VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, y VL CDR3. La región variable fuera de las CDR se refiere como la región marco (FR). Aunque no es tan diversa como las CDR, aparece variabilidad de secuencia en la región FR entre diferentes anticuerpos. Globalmente, esta arquitectura característica de los anticuerpos proporciona un soporte estable (la región FR) sobre el que el sistema inmune puede explorar una diversidad de unión a antígeno sustancial (las CDR) para obtener especificidad para una matriz amplia de antígenos. Están disponibles varias estructuras de alta resolución para una variedad de fragmentos de región variable de diferentes organismos, algunas no unidas y algunas formando un complejo con el antígeno. La secuencia y características estructurales de las regiones variables de anticuerpo están bien caracterizadas (Morea et al., 1997, Biophys Chem 68:9-16; Morea et al., 2, Methods 2:267-279), y las características conservadas de los anticuerpos han permitido el desarrollo de una gran cantidad de técnicas de ingeniería de anticuerpos (Maynard et al., 2, Annu Rev Biomed Eng 2:339-376). Por ejemplo, es posible injertar las CDR de un anticuerpo, por ejemplo un anticuerpo murino, en la región marco de otro anticuerpo, por ejemplo un anticuerpo humano. Este proceso, referido en la técnica como "humanización", permite la generación de agentes terapéuticos de anticuerpo menos inmunogénicos a partir de anticuerpos no humanos. Los fragmentos que incluyen la región variable pueden existir en ausencia de otras regiones del anticuerpo, incluyendo por ejemplo el fragmento de unión a antígeno (Fab) que incluye VH-Cy1 y VH-CL, el fragmento variable (Fv) que incluye VH y VL, el fragmento variable de cadena única (scFv) que incluye VH y VL unidos entre sí en la misma cadena, así como una variedad de otros fragmentos de región variable (Little et al., 2, Immunol Today 21:364-37).

La región Fe de un anticuerpo interacciona con varios receptores y ligandos de Fe, confiriendo un conjunto de capacidades funcionales importantes referidas como funciones efectoras. Para IgG la región Fe, como se muestra en las Figuras 1 y 2, comprende dominios Ig Cy2 y Cy3 y la bisagra N-terminal hacia Cy2. Una familia importante de receptores de Fe para la clase IgG es los receptores de Fe gamma (FcyR). Estos receptores median la comunicación entre anticuerpos y el brazo celular del sistema inmune (Raghavan et al., 1996, Annu Rev Cell Dev Biol 12:181-22; Ravetch et al., 21, Annu Rev Immunol 19:275-29). En los seres humanos, esta familia de proteínas incluye FcyRI (CD64), que incluye las isoformas FcyRIa, FcyRIb, y FcyRIc; FcyRIl (CD32), que incluye las isoformas FcyRIIa (que incluye los alotipos H131 y R131), FcyRIIb (que incluye FcyRllb-1 y FcyRllb-2), y FcyRIIc; y FcyRIII (CD16), que incluye las isoformas FcyRI lia (que incluye los alotipos V158 y F158) y FcyRIIIb (que incluye los alotipos FcyRIIIb- NA1 y FcYRIIIb-NA2) (Jefferis et al., 22, Immunol Lett 82:57-65). Estos receptores tienen típicamente un dominio extracelular que media la unión a Fe, una región que se extiende en la membrana, y un dominio intracelular que puede mediar algún evento de señalización en el interior de la célula. Estos receptores se expresan en una variedad de células inmunes que incluyen monocitos, macrófagos, neutrófilos, células dendríticas, eosinófilos, mastocitos,

plaquetas, células B, linfocltos granulares grandes, células de Langerhans, células asesinas naturales (NK), y células T YY- La formación del complejo Fc/FcyR recluta estas células efectoras a sitios de antígeno unido, lo que resulta típicamente en eventos de señalización en el Interior de las células y respuestas inmunes importantes posteriores tales como la liberación de mediadores de la Inflamación, activación de células B, endocltosls, fagocitosis, y ataque citotóxlco. La capacidad para mediar funciones efectoras citotóxicas y fagocíticas es un mecanismo potencial por el que los anticuerpos destruyen las células diana. La reacción mediada por células en la que las células citotóxicas no específicas que expresan FcyR reconocen el anticuerpo unido en una célula diana y posteriormente causan la llsls de la célula diana se refiere como cltotoxlcldad mediada por célula dependiente de anticuerpo (ADCC) (Raghavan et al., 1996, Annu Rev Cell Dev Biol 12:181-22; Ghetie et al., 2, Annu Rev Immunol 18:739-766; Ravetch et al., 21, Annu Rev Immunol 19:275-29,). La reacción mediada por células en la que las células citotóxicas no específicas que expresan FcyR reconocen anticuerpo unido en una célula diana y posteriormente causan la fagocitosis de la célula diana se refiere como fagocitosis mediada por célula dependiente de anticuerpo (ADCP). Se han resuelto varias estructuras de los dominios extracelulares de FcyR humanos, que incluyen FcyRIIa (código de acceso pdb 1H9V,)(Sondermann et al., 21, J Mol Biol 39:737-749,) (código de acceso pdb 1 FCG)(Maxwell et al., 1999, Nat Struct Biol 6:437-442), FcyRIIb (código de acceso pdb 2FCB)(Sondermann et al., 1999, Embo J 18:195-113); y FcyRIIIb (código de acceso pdb 1E4J)(Sondermann et al., 2, Nature 46:267-273). Todos los FcyR se unen a alguna región en Fe, en el extremo N-terminal del dominio Cy2 y la bisagra precedente, mostrado en la Figura 1. Esta interacción está bien caracterizada estructuralmente (Sondermann et al., 21, J Mol Biol 39:737-749), y se han resuelto varias estructuras del Fe humano unido al dominio extracelular del FcyRIIIb humano (código de acceso pdb 1E4K)(Sondermann et al., 2, Nature 46:267- 273) (códigos de acceso pdb 1IIS y 1IIX)(Radaev et al., 21, J Biol Chem 276:16469-16477), así como se ha resuelto la estructura del complejo IgE Fc/FcsRIa humano (código de acceso pdb 1 F6A)(Garman et al., 2, Nature 46:259-266). La respuesta de función efectora puede modificarse por variantes de la región Fe (Lazar... [Seguir leyendo]

 


Reivindicaciones:

1. Un polipéptido que comprende una variante de Fe de un Fe de IgG humana, en el que dicha variante de Fe comprende una isoleucina en la posición 259 y una fenilalanina en la posición 38, en el que dicha variante de Fe muestra una unión incrementada a FcRn humano comparada con dicha Fe de IgG humana, y en el que la numeración es según el índice EU en Kabat et al.

2. El polipéptido de la reivindicación 1 que comprende además una modificación adicional de aminoácidos, en la que dicha modificación adicional de aminoácidos es 428L.

3. El polipéptido de la reivindicación 1 que comprende además una modificación adicional de aminoácidos, en la que dicha modificación de aminoácidos es 434S.

4. El polipéptido de la reivindicación 1 que comprende además una modificación adicional de aminoácidos, en la que dicha modificación de aminoácidos es 37Q.

5. El polipéptido de la reivindicación 1 que comprende además una modificación adicional de aminoácidos, en la que dicha modificación de aminoácidos es 319L.

6. El polipéptido de la reivindicación 1 que comprende además una modificación adicional de aminoácidos, en la que dicha modificación de aminoácidos es 251L.

7. El polipéptido según una cualquiera de las reivindicaciones anteriores, en el que dicho polipéptido es un anticuerpo, una fusión Fe o una inmunoadhesina.

8. El polipéptido según la reivindicación 7, en el que dicha variante comprende un Fe de lgG1, un Fe de lgG2, un Fe de lgG3 o un Fe de lgG4.

9. El polipéptido según cualquiera de las reivindicaciones 7 a 8, en el que dicho polipéptido tiene una retención sérica más larga in vivo respecto a dicho Fe de IgG humana.

1. El polipéptido según la reivindicación 1, en el que dicho polipéptido es un anticuerpo lgG1 que tiene especificidad por el factor de crecimiento del endotelio vascular (VEGF), en el que dicho anticuerpo comprende: a) una cadena pesada que comprende la secuencia de aminoácidos:

E V QL VES GGGL V QPGGS LRLS C AAS G YTFTNY GMNWVRQ APGKGLE WVG W INTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYP HYYGSSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLG T QT YICNVNHKPSNTKVDKKVEPKS CD KTHT CPPCP APELLGGPS VFLFP PKPKDTLMISRTPEITCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREE Q YN ST YRV V S VLTFLHQD WLN GKE YKCKV SNKALP APIEKTISKAKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK: y b) una cadena ligera que comprende la secuencia de aminoácidos:

DIQMT QSPSSLSASV GDRVTIT C S ASQDISN YLN WY QQKPGKAPKVLIYF

TSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQ

GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKV

DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG

LSSPVTKSFNRGEC.

11. Un polipéptido según cualquiera de las reivindicaciones 7 a 1, en el que dicho polipéptido es un anticuerpo terapéutico para uso como un medicamento.

12. Una célula huésped que comprende un ácido nucleico que codifica un polipéptido según cualquiera de las reivindicaciones 1 a 1, en el que dicho polipéptido es una IgG.

13. Un método para producir un polipéptido según las reivindicaciones 1 a 1, en el que dicho polipéptido es una IgG, comprendiendo dicho método proporcionar una célula transformada con un ácido nucleico que codifica dicho polipéptido, en el que dicha célula se cultiva en condiciones para inducir o causar la expresión de dicho polipéptido.


 

Patentes similares o relacionadas:

Anticuerpos contra el antígeno de células madre específico de la próstata y su uso, del 8 de Mayo de 2019, de GEMoaB Monoclonals GmbH: Un anticuerpo que se une con antígeno de células madre específico de la próstata, en donde - las regiones determinantes de la complementariedad (CDR) de la región variable […]

Interruptores de células T con receptores de antígenos quiméricos y usos de los mismos, del 8 de Mayo de 2019, de THE SCRIPPS RESEARCH INSTITUTE: Interruptor para activar una célula efectora con receptor de antígeno quimérico (CAR-EC), comprendiendo el interruptor: a. un dominio de interacción con receptor de antígeno […]

Anticuerpos anti-CD40 y usos de los mismos, del 8 de Mayo de 2019, de BETH ISRAEL DEACONESS MEDICAL CENTER, INC.: Un anticuerpo humanizado aislado o un fragmento de unión a antígeno del mismo que se une específicamente a CD40, que comprende una región variable de cadena pesada, que […]

Receptor de antígeno quimérico (CAR) que contiene un dominio de unión a CD19, del 8 de Mayo de 2019, de UCL BUSINESS PLC: Un receptor de antígeno quimérico (CAR) que comprende un dominio de unión a CD19 que comprende a) una región variable de cadena pesada (VH) que tiene regiones determinantes […]

Moléculas de unión a antígeno activadoras de linfocitos T biespecíficas, del 8 de Mayo de 2019, de F. HOFFMANN-LA ROCHE AG: Una molécula de unión a antígeno biespecífica activadora de linfocitos T que comprende a) una primera molécula Fab que se une específicamente a un primer antígeno; […]

Anticuerpos que se pueden conjugar mediante la transglutaminasa y conjugados producidos a partir de ellos, del 8 de Mayo de 2019, de BRISTOL-MYERS SQUIBB COMPANY: Un anticuerpo de longitud completa, en el que al menos una cadena pesada tiene una extensión en el extremo C que tiene una secuencia de aminoácidos que […]

Detección de CD31 desprendido derivado de plaquetas, del 8 de Mayo de 2019, de INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM): Un fragmento de una proteína CD31 de longitud completa, que comprende al menos una parte del sexto dominio extracelular de tipo inmunoglobulina de dicha proteína […]

Anticuerpos ANTI-EGFRVIII y usos de los mismos, del 8 de Mayo de 2019, de REGENERON PHARMACEUTICALS, INC.: Un anticuerpo aislado y fragmento de unión a antígeno del mismo que se une específicamente a EGFRvIII humana, en donde el anticuerpo o fragmento del mismo comprende […]

Otras patentes de Xencor Inc

 

Otras patentes de la CIP C07K16/32