PÉPTIDO CAPAZ DE ALTERAR LA POLIMERIZACIÓN DE LA TUBULINA Y SU UTILIZACIÓN PARA INHIBIR LA PROLIFERACIÓN CELULAR.

Péptido aislado, caracterizado porque consiste en un péptido que presenta por lo menos 80%,

preferentemente 85%, 90%, 95%, 98% y 100% de identidad después de la alineación óptima con una secuencia seleccionada de entre SEC ID nº 5, SEC ID nº 6, SEC ID nº 7 SEC ID nº 8, SEC ID nº 17, SEC ID nº 18, SEC ID nº 19, SEC ID nº 20, SEC ID nº 21, SEC ID nº 22, SEC ID nº 23, SEC ID nº 24, SEC ID nº 25, SEC ID nº 26, SEC ID nº 27 o SEC ID nº 28 o uno de sus fragmentos biológicos artificial de por lo menos 5 aminoácidos, capaz de alterar la polimerización de la tubulina.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/FR2005/000990.

Solicitante: UNIVERSITE D'ANGERS.

Nacionalidad solicitante: Francia.

Dirección: 40, RUE DE RENNES 49000 ANGERS FRANCIA.

Inventor/es: BOCQUET,Arnaud, EYER,Joël, PETERSON,Alan.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/17 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00). › que provienen de animales; que provienen de humanos.
  • A61P31/04 A61 […] › A61P ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS O DE PREPARACIONES MEDICINALES.A61P 31/00 Antiinfecciosos, es decir antibióticos, antisépticos, quimioterápicos. › Agentes antibacterianos.
  • A61P35/00 A61P […] › Agentes antineoplásicos.
  • C07K14/47 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › de mamíferos.
  • C12N15/12 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K). › Genes que codifican proteínas animales.
  • C12N15/63 C12N 15/00 […] › Introducción de material genético extraño utilizando vectores; Vectores; Utilización de huéspedes para ello; Regulación de la expresión.
  • G01N33/68 SECCION G — FISICA.G01 METROLOGIA; ENSAYOS.G01N INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION DE SUS PROPIEDADES QUIMICAS O FISICAS (procedimientos de medida, de investigación o de análisis diferentes de los ensayos inmunológicos, en los que intervienen enzimas o microorganismos C12M, C12Q). › G01N 33/00 Investigación o análisis de materiales por métodos específicos no cubiertos por los grupos G01N 1/00 - G01N 31/00. › en los que intervienen proteínas, péptidos o aminoácidos.

PDF original: ES-2375632_T3.pdf

 


Fragmento de la descripción:

Péptido capaz de alterar la polimerización de la tubulina y su utilización para inhibir la proliferación celular.

La presente invención tiene por objeto un péptido procedente de filamentos intermedios y un fragmento de filamento intermedio capaces de alterar la polimerización de la tubulina y utilizados para inhibir la proliferación celular, y más particularmente para la obtención de medicamentos destinados a prevenir o tratar las enfermedades que implican una proliferación celular, tal como por ejemplo los cánceres.

La división celular, o mitosis, es el proceso que permite que las células se multipliquen con el fin de construir o regenerar los tejidos y sustituir las células muertas. En las células cancerígenas, la regulación de este proceso falla, por lo cual estas células se dividen de manera anárquica y crean así tumores. Una de las vías terapéuticas eficaz para luchar contra los cánceres consiste en bloquear la división de las células cancerígenas.

Las moléculas antimitóticas actuales (Taxol o Colchicina) actúan sobre todas las células sin distinción y provocan por consiguiente numerosos efectos secundarios.

Por lo tanto, es esencial desarrollar unas moléculas antimitóticas, es decir moléculas que bloquean la división de las células cancerígenas, que comprenden muchos menos efectos secundarios.

La tubulina es una molécula fundamental del proceso de la división celular. En efecto, ésta se polimeriza para formar los microtúbulos que son indispensables para el transporte intracelular durante la mitosis.

Los microtúbulos son uno de los elementos más importantes del citoesqueleto axonal en el que desempeñan un papel esencial en el transporte axonal funcionando como raíles a lo largo de los cuales los organelos se mueven en las dos direcciones anterógradas y retrógradas gracias a proteínas locomotoras específicas. Los microtúbulos están en equilibrio dinámico con los dímeros de tubulina y su acoplamiento está regulado en gran medida gracias a la asociación de las proteínas adicionales que permiten aumentar o reducir la estabilidad de los microtúbulos, como por ejemplo las proteínas MAP (revisión por Mandelkow y Mandelkow, 1995) , las proteínas STOP (Guillaud et al., 1998) y las proteínas OP18 (Cassimeris, 2002) . Los axones dependen de los microtúbulos para el transporte axoplásmico y de los neurofilamentos para su crecimiento radial.

Los neurofilamentos (NF) son la clase mayoritaria de los filamentos intermedios expresada por las neuronas maduras (Hoffman et al., 1987) . Están compuestos por tres subunidades codificadas independientemente, los neurofilamentos ligeros (NFL) , los neurofilamentos medios (NFM) y los neurofilamentos pesados (NFH) de 68, 150 y 200 kDa respectivamente. El eje de cada neurofilamento está formado por unas subunidades NFL. Las subunidades NFM y NFH se fijan sobre este eje gracias a unas interacciones de tipo hélice-hélice situadas en sus dominios centrales. Los dominios carboxi-terminales de NFM y NHF forman unas proyecciones laterales particularmente largas que permiten las interacciones interfilamentos y la asociación de neurofilamentos con otros organelos (Hirokawa, 1982) . El estado de fosforilación de las unidades KSP repetidas en estas proyecciones laterales (Julien y Mushynski, 1982; De Waegh et al., 1992; Lee et al., 1988) se conoce para modular la afinidad interfilamentos (Eyer y Leterrier, 1988) , el espacio interfilamentos (Garden et al., 1987) , la interacción con la tubulina (Hisanaga e Hirokawa, 1990) , la velocidad de transporte de los neurofilamentos (De Waegh et al., 1992) y el crecimiento radial de los axones (Ohara et al., 1993; Eyer y Peterson, 1994; Zhu et al., 1997) .

Se sabe que los filamentos intermedios tienen la particularidad de ser diferentes de un tejido a otro. Así, los neurofilamentos están presentes únicamente en las células neuronales, los gliofilamentos en las células gliales, los filamentos de desmina en las células musculares, y los filamentos de queratinas en las células de la epidermis.

De manera sorprendente e inesperada, los inventores han demostrado que unos fragmentos de filamentos intermedios pueden unir la tubulina y alterar la polimerización de los microtúbulos. Además, los inventores han demostrado que la utilización de un péptido que une la tubulina y que inhibe o desactiva la polimerización de los microtúbulos permite bloquear la división celular.

Además, dichos péptidos proceden de la secuencia de filamentos intermedios, los cuales son específicos del tejido. Estos péptidos no parecen por lo tanto provocar los efectos secundarios de moléculas anti-mitóticas actuales.

La invención tiene por lo tanto por objeto un péptido aislado, caracterizado porque consiste en un péptido que presenta por lo menos 80%, preferentemente 85%, 90%, 95%, 98% y 100%, de identidad después de la alineación óptima con una secuencia seleccionada de entre

SEC ID nº 5 (FGYDPYFSTSYKRRYVETPRVHIS) , SEC ID nº 6 (YSSYSAPVSSSLSVRRSYSSSSGS) , SEC ID nº 7 (AYRRVPTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSS) , SEC ID nº 8 (RSAAGSSSGFHSWARTSVSSVSASPSRFRGAASSTDSLD) , SEC ID nº 17 (MSQAYSSSQRVSSYRRTFGGAPGFSLG) ,

SEC ID nº 18 (SSPVFPRAGFGTKGSSSSMTSRVYQVSRTSGGAGGLGSLRSSRLGTTRAPSYGA) , SEC ID nº 19 (GSEVHTKKTVMIKTIETRDGE) , SEC ID nº 20 (MSTRSVSSSSYRRMFGGS) , SEC ID nº 21 (GGAYVTRSSAVRLRSSVPGVRLLQ) , SEC ID nº 22 (SLPLVDTHSKRTLLIKTVETR) , SEC ID nº 23 (MSIRVTQKSYKMSTSGPRAFSSRSFTSGPGARISSSSFSRVGSSSSSFRGSMGT) , SEC ID nº 24 (QIKSLNNKFASFIDKVRFLEQ) , SEC ID nº 25 (SAGGSNTFSRTTKAVVVKKIETRDGKLVSE) , SEC ID nº 26 (MERRRITSARRSYASETVVRGLGP) , SEC ID nº 27 (VRGLGPSRQLGTMPRFSLSRMTPPLPARVDFSLAGA) , SEC ID nº 28 (KSVSEGHLKRNIVVKTVEMRD)

o uno de sus fragmentos biológicos artificial de por lo menos 5 aminoácidos capaz de alterar la polimerización de la tubulina.

Mediante la expresión "alterar la polimerización de la tubulina" se entiende o bien inhibir, o bien activar la polimerización de la tubulina.

En la presente invención, se entenderá designar por el término "péptido" asimismo los polipéptidos.

Ventajosamente, dicho péptido presenta por lo menos 90% de identidad después de la alineación óptima con una secuencia seleccionada de entre SEC ID nº 5, SEC ID nº 6, SEC ID nº 7, SEC ID nº 8, SEC ID nº 17, SEC ID nº 18, SEC ID nº 19, SEC ID nº 20, SEC ID nº 21, SEC ID nº 22, SEC ID nº 23, SEC ID nº 24, SEC ID nº 25, SEC ID nº 26, SEC ID nº 27 o SEC ID nº 28. De manera aún más ventajosa, dicho péptido presenta por lo menos 100% de identidad después de la alineación óptima con una secuencia seleccionada de entre SEC ID nº 5, SEC ID nº 6, SEC ID nº 7, SEC ID nº 8, SEC ID nº 17, SEC ID nº 18, SEC ID nº 19, SEC ID nº 20, SEC ID nº 21, SEC ID nº 22, SEC ID nº 23, SEC ID nº 24, SEC ID nº 25, SEC ID nº 26, SEC ID nº 27 o SEC ID nº 28, y sus combinaciones.

Mediante la expresión "porcentaje de identidad" entre dos secuencias de ácido nucleico o de aminoácido, en el sentido de la presente invención, se entiende designar un porcentaje de nucleótidos o de residuos de aminoácidos idénticos entre las dos secuencias a comparar, obtenido después de la mejor alineación (alineación óptima) , siendo este porcentaje puramente estadístico y siendo las diferencias entre las dos secuencias repartidas al azar y sobre toda su longitud. Las comparaciones de secuencias entre dos secuencias de ácido nucleico o de aminoácido se realizan habitualmente comparando estas secuencias después de haberlas alineado de manera óptima, pudiendo ser realizada dicha comparación por segmento o por "ventana de comparación". La alineación óptima de las secuencias para la comparación se puede realizar, además de manualmente, por medio del algoritmo de homología local de Smith y Waterman (1981) [Ad. App. Math. 2:482], por medio del algoritmo de homología local de Neddleman y Wunsch (1970) [J. Mol. Biol. 48:443], por medio del método de búsqueda de identidad de Pearson y Lipman (1988) [Proc. Natl. Acad. Sci. USA 85:2444], por medio de programas informáticos que utilizan estos algoritmos (GAP, BESTFIT, FASTA y TFASTA en el Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI, o también mediante los programas de comparación BLAST N, o BLAST P, ClustalW) .

El porcentaje de identidad entre dos secuencias de ácido nucleico o de aminoácido se determina comparando estas dos secuencias alineadas... [Seguir leyendo]

 


Reivindicaciones:

1. Péptido aislado, caracterizado porque consiste en un péptido que presenta por lo menos 80%, preferentemente 85%, 90%, 95%, 98% y 100% de identidad después de la alineación óptima con una secuencia seleccionada de entre SEC ID nº 5, SEC ID nº 6, SEC ID nº 7 SEC ID nº 8, SEC ID nº 17, SEC ID nº 18, SEC ID nº 19, SEC ID nº 20, SEC ID nº 21, SEC ID nº 22, SEC ID nº 23, SEC ID nº 24, SEC ID nº 25, SEC ID nº 26, SEC ID nº 27 o SEC ID nº 28

o uno de sus fragmentos biológicos artificial de por lo menos 5 aminoácidos, capaz de alterar la polimerización de la tubulina.

2. Péptido según la reivindicación 1, de secuencia seleccionada de entre SEC ID nº 5, SEC ID nº 6, SEC ID nº 7, SEC ID nº 8, SEC ID nº 17, SEC ID nº 18, SEC ID nº 19, SEC ID nº 20, SEC ID nº 21, SEC ID nº 22, SEC ID nº 23, SEC ID nº 24, SEC ID nº 25, SEC ID nº 26, SEC ID nº 27 o SEC ID nº 28.

3. Péptido según cualquiera de las reivindicaciones 1 y 2, caracterizado porque se obtiene por vía recombinante o por síntesis química.

4. Ícido nucleico aislado que codifica para un péptido según cualquiera de las reivindicaciones 1 a 3.

5. Ícido nucleico según la reivindicación 4, que presenta por lo menos 80%, preferentemente 85%, 90%, 95%, 98% y 100% de identidad después de la alineación óptima con una secuencia seleccionada de entre SEC ID nº 1, SEC ID nº 2, SEC ID nº 3, SEC ID nº 4, SEC ID nº 29, SEC ID nº 30, SEC ID nº 31, SEC ID nº 32, SEC ID nº 33, SEC ID nº 34, SEC ID nº 35, SEC ID nº 36, SEC ID nº 37, SEC ID nº 38, SEC ID nº 39 o SEC ID nº 40.

6. Vector, caracterizado porque comprende un ácido nucleico según cualquiera de las reivindicaciones 4 y 5.

7. Célula hospedante, caracterizada porque es transformada por un ácido nucleico según cualquiera de las reivindicaciones 4 y 5, o un vector según la reivindicación 6.

8. Procedimiento de producción de péptido recombinante según cualquiera de las reivindicaciones 1 a 3, caracterizado porque comprende las etapas siguientes:

a) cultivar una célula según la reivindicación 7, en un medio de cultivo y condiciones de cultivo apropiados, b) recuperar dicho péptido a partir de las células o del medio de cultivo obtenido en la etapa a) .

9. Composición farmacéutica que comprende un péptido según cualquiera de las reivindicaciones 1 a 3, y/o obtenido mediante un procedimiento según la reivindicación 8, con un vehículo farmacéuticamente aceptable.

10. Péptido según cualquiera de las reivindicaciones 1 a 3 y/o obtenido mediante un procedimiento según la reivindicación 8, para su utilización para inhibir la proliferación celular y/o la movilidad celular, con el fin de prevenir o tratar una enfermedad seleccionada de entre los cánceres, las infecciones bacterianas, las enfermedades que implican una proliferación de ciertas plantas como las algas o los líquenes, o la soriasis.

11. Péptido según la reivindicación 10, para su utilización para inhibir la angiogénesis durante el crecimiento tumoral.

12. Péptido según la reivindicación 10, para su utilización para inhibir la multiplicación bacteriana.

13. Péptido según cualquiera de las reivindicaciones 1 a 3 y/o obtenido mediante un procedimiento según la reivindicación 8 para su utilización in vitro como marcador de la tubulina.

14. Péptido según cualquiera de las reivindicaciones 1 a 3 y/o obtenido mediante un procedimiento según la reivindicación 8, para su utilización como medicamento.

15. Péptido según la reivindicación 14, caracterizado porque el medicamento está destinado a prevenir o tratar enfermedades que implican una proliferación celular y/o una motilidad celular, a saber las infecciones bacterianas, las enfermedades que implican una proliferación de ciertas plantas como las algas o los líquenes, o la soriasis.

16. Péptido según la reivindicación 14, caracterizado porque el medicamento está destinado a prevenir o tratar unos cánceres.

17. Péptido según la reivindicación 16, caracterizado porque el cáncer es un cáncer del sistema nervioso.

18. Utilización de un péptido según cualquiera de las reivindicaciones 1 a 3 y/o obtenido mediante un procedimiento según la reivindicación 8, para la demostración y/o para ensayar in vitro unos productos susceptibles de bloquear la interacción entre la tubulina y dicho péptido.

19. Utilización de un fragmento de filamento intermedio capaz de alterar la polimerización de la tubulina

seleccionado de entre la citoqueratina endoA que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 9, la queratina 8 que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 10, la periferina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 11, la internexina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 12, la GFAP que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 13 o la vimentina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 14, para la preparación de un medicamento destinado a prevenir o tratar unas enfermedades que implican la proliferación celular y/o la movilidad celular, seleccionadas de entre los cánceres, las infecciones bacterianas, las enfermedades que implican una proliferación de ciertas plantas como las algas o los líquenes, o la soriasis.

20. Utilización in vitro de un fragmento de filamento intermedio capaz de alterar la polimerización de la tubulina seleccionado de entre la citoqueratina endoA que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 9, la queratina 8 que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 10, la periferina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 11, la internexina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 12, la GFAP que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 13 o la vimentina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 14 como marcador de la tubulina.

21. Fragmento de filamento intermedio capaz de alterar la polimerización de la tubulina seleccionado de entre la citoqueratina endoA que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 9, la queratina 8 que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 10, la periferina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 11, la internexina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 12, la GFAP que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 13 o la vimentina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 14 para su utilización como medicamento.

22. Utilización de un fragmento de filamento intermedio capaz de alterar la polimerización de la tubulina seleccionado de entre la citoqueratina endoA que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 9, la queratina 8 que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 10, la periferina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 11, la internexina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 12, la GFAP que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 13 o la vimentina que presenta por lo menos 80%, preferentemente 85%, 90%, 98% y 100% de identidad después de la alineación óptima con la secuencia SEC ID nº 14 para la demostración y/o para ensayar in vitro unos productos susceptibles de bloquear la interacción entre la tubulina y dicho fragmento de filamento intermedio.

 

Patentes similares o relacionadas:

Compuestos y composiciones como inhibidores de quinasa, del 31 de Octubre de 2019, de NOVARTIS AG: El compuesto de fórmula Ia:**Fórmula** en donde: R1 se selecciona entre hidrógeno y metil; R2 se selecciona entre piridinilo y fenilo; donde […]

Imagen de 'Tratamiento del cáncer de ovario utilizando un agente anticancerígeno…'Tratamiento del cáncer de ovario utilizando un agente anticancerígeno conjugado con un análogo de Angiopep-2, del 31 de Octubre de 2019, de ANGIOCHEM INC: Un conjugado para uso en el tratamiento de un paciente que tiene cáncer metastásico del ovario, en donde dicho cáncer es resistente a un tratamiento con taxano, […]

Derivado de urea y utilización del mismo, del 30 de Octubre de 2019, de TORAY INDUSTRIES, INC.: Derivado de urea representado por la fórmula (I): **(Ver fórmula)** en la que, R1 es trifluorometilo, trifluorometoxi o pentafluorosulfanilo; […]

Nuevos derivados de amonio, un proceso para su preparación y composiciones farmacéuticas que los contienen, del 30 de Octubre de 2019, de LES LABORATOIRES SERVIER: Compuestos de fórmula (I):**Fórmula** en donde: • Y representa un grupo -NH- o un átomo de oxígeno, • R1 representa un grupo alquilo(C1-C6) lineal o […]

Derivados de 7-(morfolin-4-il)pirazol[1,5-a]pirimidina que son útiles para el tratamiento de enfermedades inmunitarias o inflamatorias o cáncer, del 30 de Octubre de 2019, de CELON PHARMA S.A: Un compuesto de la fórmula general (I) **(Ver fórmula)** en donde: Y representa -CH2- o >C=O; R1 se selecciona del grupo que consiste en […]

Métodos y composiciones para la inmunoterapia contra el cáncer usando células tumorales que expresan la proteína de fusión de flagelina y antígeno asociado al tumor, del 30 de Octubre de 2019, de CORNELL UNIVERSITY (100.0%): Una composición que comprende una célula dendrítica (CD), donde dicha CD ha interiorizado una célula tumoral que expresa una proteína de fusión, […]

Inmunoterapia novedosa contra diversos tumores, entre ellos tumores cerebrales y neuronales, del 30 de Octubre de 2019, de IMMATICS BIOTECHNOLOGIES GMBH: Péptido consistente en la secuencia de aminoácidos acorde con la SEQ ID N.º 6 para el uso en el tratamiento del cáncer.

Compuestos de 7-feniletilamino-4H-pirimido[4,5-D][1,3]oxazin-2-ona y su uso como inhibidores de IDH1 mutantes, del 30 de Octubre de 2019, de ELI LILLY AND COMPANY: Un compuesto de la fórmula: **(Ver fórmula)** en la que L es un engarce seleccionado entre el grupo que consiste en -N-azetidina-3-CH2-O-, -N-azetidina-3-O-(CH2)-, […]

Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .