Composición tensioactiva reconstituida mejorada que contiene análogos de proteína tensioactiva B (SP-B) y proteína tensioactiva C (SP-C).

Una composición de tensioactivo reconstituido que comprende:

a) de 1,

2 a 1,8 % en peso de un análogo polipeptídico de la proteína tensioactiva SP-C nativa que consiste en la secuencia representada por la fórmula IPSSPVHLKRLKLLLLLLLLILLLILGALLLGL (SEQ ID NO: 1);

b) de 0,1 a 0,5 % en peso de un análogo polipeptídico de la proteína tensioactiva SP-B nativa que consiste en la secuencia representada por la fórmula CWLCRALIKRIQALIPKGGRLLPQLVCRLVLRCS (SEQ ID NO: 2);

c) un fosfolípido monoinsaturado y un fosfolípido saturado en una relación en peso que oscila entre 45:55 a 55:45; en el que dicho fosfolípido monoinsaturado se selecciona entre el grupo que consiste en palmitoiloleilfosfatidilcolina (POFC) y palmitoiloleilfosfatidilglicerol (POFG), y en el que dicho fosfolípido saturado se selecciona entre el grupo que consiste en dipalmitoilfosfatidilcolina (DPFC) y dipalmitoilfosfatidilglicerol (DPFG);

todas las cantidades siendo calculadas en relación con el peso total del tensioactivo reconstituido.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2010/003293.

Solicitante: CHIESI FARMACEUTICI S.P.A..

Nacionalidad solicitante: Italia.

Dirección: VIA PALERMO, 26/A 43100 PARMA ITALIA.

Inventor/es: PIVETTI,FAUSTO, SOLIANI RASCHINI,ANNAMARIA, BOCCHI,MONICA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/00 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).
  • C07K14/785 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › Péptidos surfactantes alveolares; Péptidos surfactantes pulmonares.

PDF original: ES-2621974_T3.pdf

 

Patentes similares o relacionadas:

Agente terapéutico específico de enfermedad pulmonar, del 8 de Mayo de 2019, de Cardio Incorporated: Agente terapéutico específico de pulmón para una utilización en la terapia de una enfermedad pulmonar, en el que el agente terapéutico comprende microesferas […]

Formulación y método para aumentar la biodisponibilidad oral de fármacos, del 8 de Mayo de 2019, de YISSUM RESEARCH DEVELOPMENT COMPANY OF THE HEBREW UNIVERSITY OF JERUSALEM LTD: Una composición para la administración oral de al menos un fármaco, comprendiendo dicha composición: a) un concentrado dispersable, caracterizado por ser […]

Receptores de linfocitos T, del 8 de Mayo de 2019, de Adaptimmune Limited: Un receptor de linfocitos T (RLC) de origen no natural y/o purificado y/o modificado por ingeniería genética, que tiene la propiedad de unirse […]

Péptidos KNTC2 y vacunas que los contienen, del 8 de Mayo de 2019, de ONCOTHERAPY SCIENCE, INC.: Un péptido aislado de menos de 15 aminoácidos que tiene la capacidad de inducir un linfocito(s) T citotóxico (CTL), en donde el péptido comprende una secuencia de […]

Composiciones de nanopartículas lipídicas y métodos para la administración ARNm, del 8 de Mayo de 2019, de Translate Bio, Inc: Una composición que comprende (a) al menos una molécula de ARNm al menos una porción de la cual codifica un polipéptido secretado funcional; y (b) un vehículo de transferencia […]

Método para tratar el eccema, del 8 de Mayo de 2019, de DBV TECHNOLOGIES: Un alérgeno seleccionado comprendido en un dispositivo de parche para la piel, para uso en un método para tratar el eccema en un sujeto mediante la aplicación repetida del dispositivo […]

Composiciones farmacéuticas que comprenden agonistas selectivos del receptor de melanocortina 1 y su uso en métodos terapéuticos, del 8 de Mayo de 2019, de UNIVERSITY OF CINCINNATI: Una composición farmacéutica que comprende: (a) una cantidad efectiva de un agonista peptídico selectivo del receptor de melanocortina 1 (MC1R) de […]

Métodos para aliviar síntomas de esclerosis múltiple basados en composiciones que contienen apoacuorina, del 29 de Abril de 2019, de QUINCY BIOSCIENCE, LLC: Apoacuorina para uso en aliviar un síntoma asociado con esclerosis múltiple en un sujeto, en donde la apoacuorina se formula como una […]

Otras patentes de CHIESI FARMACEUTICI S.P.A.