132 patentes, modelos y diseños de CHIESI FARMACEUTICI S.P.A.

Derivados del alcohol de 1-fenil-2-piridinil alquilo como inhibidores de la fosfodiesterasa.

(20/02/2019) Un compuesto de la Fórmula general (I)**Fórmula** en donde: R1 y R2 son iguales o diferentes y se seleccionan independientemente del grupo que consiste en hidrógeno, metilo, etilo, difluorometilo, ciclopropilmetilo o ciclopropilo; R3 son los mismos dos átomos de cloro en la posición 3 y 5 del anillo piridilo; Z es un grupo (CH2)m en donde m = 0; A es un anillo de fenilo, que está opcionalmente sustituido con uno o más sustituyentes R4, que pueden ser iguales o diferentes y se seleccionan independientemente del grupo que consiste en: (C1-C2)alquilo lineal o ramificado opcionalmente sustituido por uno o…

Derivados de 3-oxo-2,3,5,8-tetrahidro-[1,2,4]triazolo[4,3-a]pirimidina para el tratamiento de enfermedades respiratorias.

(14/02/2019) Un compuesto de fórmula (I) o una sal farmacéuticamente aceptable del mismo: **(Ver fórmula)** en la que A es CH; B es CH; D es CH; R1 se selecciona entre la lista que consiste en: - hidrógeno; - alquilo (C1-C6); - NR7R8alquilo (C1-C6); - alquenilo (C1-C4); - fenilalquilo (C1-C6) en el que dicho anillo fenilo está opcionalmente sustituido por un grupo NR15R16alquilo (C1-C6) o por N+R15R16R17alquilo (C1-C6); - un grupo -CH2(CH2)nOH; - un grupo -(CH2)nCONR5R6; - un grupo -(CH2)nSO2NR5R6; - un grupo -CH2-(CH2)nNR5SO2R6; - un grupo -(CH2)t-(C6H4)-SO2alquilo (C1-C4); - un grupo -(CH2)rSO2alquilo (C1-C4) en el que dicho alquilo (C1-C4) está opcionalmente sustituido por un grupo -NR15R16 o -N+R15R16R17; - un grupo -SO2-fenilo en el que dicho anillo fenilo está opcionalmente sustituido…

Formulación de polvo seco que comprende un anticolinérgico, un corticosteroide y un betaadrenérgico para administración por inhalación.

(13/02/2019) Una formulación de polvo seco para su uso en un inhalador de polvo seco (DPI) para administrar por inhalación una combinación de partículas micronizadas de bromuro de glicopirronio, dipropionato de beclometasona y fumarato de formoterol dihidratado como ingredientes activos en una dosis combinada terapéuticamente eficaz compuesta de 100 a 500 mg, comprendiendo dicha formulación: a) una fracción de partículas finas que consiste en una mezcla de 90 a 99,5 por ciento en peso de partículas micronizadas de un excipiente fisiológicamente aceptable y 0,5 a 10 por ciento en peso de estearato de magnesio, en la que…

Un proceso para la concentración de un polipéptido.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(09/01/2019). Inventor/es: NILSSON, STEFAN. Clasificación: C12N9/00, A61K38/47, A61P25/00, C12N9/10, A61K38/46, C07K1/36, A61K38/45, C07K1/34.

Una composición que comprende al menos 10 mg/ml de alfa-manosidasa, y en donde menos del 5 % de la cantidad total de la alfa-manosidasa en dicha composición está presente en la forma de agregados, abarcando dichos agregados cualquier dímero o multímero de la alfa-manosidasa.

PDF original: ES-2713488_T3.pdf

Derivados aminoéster.

(07/11/2018) Un compuesto de fórmula general (I) **Fórmula** en el que cada R1 es hidrógeno o se selecciona independientemente del grupo que consiste en: halógeno, alquilo (C1-C4), alcoxi (C1-C4), haloalquilo (C1-C4), hidroxilo, -SO2NRIRII, -CN, -NRISO2RIII, -NRIRII, -(CO)NRIRII y -NRI(CO)RIII, y en los que dicho alquilo (C1-C4) está opcionalmente sustituido con uno o más grupos seleccionados entre cicloalquilo (C3-C7), hidroxilo y -NRIRII y en los que dicho alcoxi (C1-C4) está opcionalmente sustituido con uno o más halógenos o grupos cicloalquilo (C3-C7) en los que, RI es hidrógeno o alquilo (C1-C6); RII es hidrógeno o alquilo (C1-C6); RIII es hidrógeno o alquilo (C1-C6); n es un número entero…

Formulaciones basadas en melatonina para la administración parenteral.

Sección de la CIP Necesidades corrientes de la vida

(25/10/2018). Inventor/es: SOLIANI RASCHINI,ANNAMARIA, TÜRELI,AKIF EMRE, PRINZ,EVA MARIE. Clasificación: A61P43/00, A61K9/14, A61K31/4045, A61K9/51, A61K9/19.

Una formulación farmacéutica que comprende un polvo para dispersar en un vehículo acuoso y adecuado para la administración parenteral a neonatos afectados por lesión cerebral, dicho polvo consiste en: i) 5 20 a 75 % en peso de nanopartículas que consisten en melatonina como ingrediente activo en adición con uno o más fosfolípidos que tienen una pureza igual o superior a 99 % y se seleccionan del grupo que consiste en fosfatidilcolinas, fosfatidilgliceroles, fosfatidiletanolaminas, fosfatidilserinas, fosfatidilinositol y lecitinas, en donde la relación entre la melatonina y el fosfolípido varía entre 90:10 y 20:80 en peso, y ii) 25 a 80 % en peso de una mezcla de manitol y trehalosa como agente crioprotector; en donde al menos uno de dichos fosfolípidos se absorbe en la superficie de la melatonina, y la relación entre el manitol y la trehalosa es de 6:4 a 4:6 en peso.

PDF original: ES-2687484_T3.pdf

Composición de solución en aerosol presurizado estable de una combinación de bromuro de glucopirronio y formoterol.

Sección de la CIP Necesidades corrientes de la vida

(24/10/2018). Inventor/es: DAGLI ALBERI,MASSIMILIANO, BONELLI,SAURO, ZAMBELLI,ENRICO, USBERTI,FRANCESCA, COPELLI,DIEGO. Clasificación: A61M15/00, A61K9/06, A61K31/40, A61K9/00, A61K31/573, A61K31/167, A61K9/12, A61K45/06, A61K31/58, A61M39/22.

Una composición farmacéutica de solución en aerosol destinada para su uso en un inhalador dosificador presurizado que comprende: (a) bromuro de glucopirronio a una dosificación en el intervalo de 5 a 26 μg por accionamiento; (b) formoterol, o una sal del mismo o un solvato de dicha sal, a una dosificación en el intervalo de 1 a 25 μg por accionamiento; (c) un propulsor de HFA; (d) un cosolvente; (e) una cantidad estabilizadora de un ácido mineral; estando contenida dicha composición en un bote de aerosol revestido internamente mediante una resina que comprende un polímero de etileno propileno fluorado (FEP).

PDF original: ES-2687345_T3.pdf

Formulación en polvo seca que comprende un corticoesteroide y un beta-adrenérgico para administración por inhalación.

(25/09/2018) Una formulación en polvo seca para uso en un inhalador de polvo seco (DPI), que comprende: a) una fracción de partículas finas hecha de una mezcla de 90 a 99.5 por ciento en peso de partículas de monohidrato de alpha lactosa y 0.5 a 10 por ciento en peso de estearato de magnesio, donde dicha mezcla tiene una mediana de diámetro de masa menor a 20 micrones; b) una fracción de partículas gruesas constituida por monohidrato de alpha lactosa que tiene una mediana de diámetro de masa igual a o mayor a 175 micrones, en la que la relación entre las partículas finas y las partículas gruesas está entre 2:98 y 20:80 por ciento en peso; y c1) dihidrato de formoterol fumarato en la forma de partículas micronizadas; c2) beclometasona dipropionato (BDP) en la forma de partículas micronizadas; en la que i) no más de 10% de dichas partículas…

Derivados de isoxazolidina.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(16/05/2018). Inventor/es: GHIDINI, ELEONORA. Clasificación: A61P11/00, A61K31/58, C07J71/00.

Un compuesto de fórmula general (I)**Fórmula** en la que R1 se selecciona del grupo que consiste en alquilo (C1-C16) lineal o ramificado, alquenilo (C2-C18) lineal o ramificado, - OR6, arilo, arilalquilo (C1-C16), -SR6, -N(R4)(R5), cicloalquilo (C3-C8), heterocicloalquilo (C3-C8) y heteroarilo, donde opcionalmente uno o más átomos de hidrógeno están reemplazados por alquilo (C1-C6), y en donde R4 y R5 se seleccionan independientemente de H o alquilo (C1-C6) lineal o ramificado y R6 es alquilo (C1-C16) lineal o ramificado; R2 es arilo opcionalmente sustituido con uno o más átomos de halógeno; y sales farmacéuticamente aceptables de los mismos.

PDF original: ES-2672140_T3.pdf

Proceso para preparar partículas vehículo para polvos secos para inhalación.

Sección de la CIP Necesidades corrientes de la vida

(09/05/2018). Inventor/es: MUSA, ROSSELLA, COCCONI,DANIELA, CHAMAYOU,ALAIN, GALET,LAURENCE. Clasificación: A61K31/40, A61K9/72, A61K31/573, A61K31/167, A61K9/16, A61K9/50, A61K31/57, A61K9/14.

Una composición farmacéutica en forma de polvo seco para inhalación que comprende uno o más ingredientes activos y partículas vehículo constituidas por partículas de lactosa que tienen un diámetro de masa en el intervalo de 90 a 400 micras recubiertas con 0.1-1.0 por ciento de estearato de magnesio en peso del vehículo en una extensión tal que las partículas recubiertas tienen una extensión del recubrimiento superficial superior al 60%, pudiendo obtenerse dichas partículas vehículo mediante un proceso que comprende recubrimiento seco en un granulador mezclador de alto cizallamiento basado en el comportamiento de fricción a una velocidad de rotación comprendida entre 1000 y 1500 r.p.m.

PDF original: ES-2675575_T3.pdf

Métodos para controlar la presión arterial y reducir la disnea en la insuficiencia cardiaca.

Sección de la CIP Necesidades corrientes de la vida

(11/04/2018). Inventor/es: WILLIAMS,GREGORY CHARLES, SPINDLER,EDWARD C. JR, ITRI,LORETTA M, HU,MING-YI. Clasificación: A61K9/00, A61P9/00, A61K31/4422.

Una composición farmacéutica que comprende clevidipino para su uso en la reducción de la disnea en un paciente que tiene una insuficiencia cardiaca aguda y una presión arterial sistólica en la situación inicial de entre 120 mm de Hg y menos de 160 mm de Hg.

PDF original: ES-2671639_T3.pdf

Compuestos que tienen actividad antagonista del receptor muscarínico y agonista del receptor beta2 adrenérgico.

(21/03/2018) Un compuesto que se selecciona entre el grupo que consiste en: 4-((3-((S)-fenil((((R)-quinuclidin-3-iloxi)carbonil)-amino)metil)fenoxi)metil)benzoato de 2-(4-((((R)-2-hidroxi-2-(8- hidroxi-2-oxo-1,2-dihidroquinolin-5-il)etil)amino)-metil)-2-metilfenoxi)etilo; 4-((3-((S)-fenil((((R)-quinuclidin-3-iloxi)carbonil)amino)-metil)fenoxi)metil)benzoato de 2-(4-((((R)-2-hidroxi-2-(8-hidroxi-2-oxo-1,2-dihidroquinolin-5-il)etil)amino)-metil)fenoxi)etilo; 4-((3-((S)-fenil((((R)-quinuclidin-3-iloxi)carbonil)amino)-metil)fenoxi)metil)benzoato de 2-(2-cloro-4-((((R)-2-hidroxi- 2-(8-hidroxi-2-oxo-1,2-dihidroquinolin-5-il)etil)-amino)metil)fenoxi)etilo; 4-((3-((S)-fenil((((R)-quinuclidin-3-iloxi)carbonil)-amino)metil)fenoxi)metil)benzoato…

Uso medicinal de alfa-manosidasa.

Sección de la CIP Necesidades corrientes de la vida

(14/03/2018). Inventor/es: FOGH, JENS, ANDERSSON, CLAES, VON FIGURA,Kurt, WEIGELT,CECILIA, ROCES,DIEGO PRIETO, IRANI,MEHER. Clasificación: A61K38/47, A61P25/00, A61K38/46.

Uso de una alfa-manosidasa lisosómica para la preparación de un medicamento para el tratamiento de alfamanosidosis, en el que dicho medicamento debe administrarse por administración intravenosa.

PDF original: ES-2672646_T3.pdf

Compuestos que tienen actividad antagonista del receptor muscarínico y actividad agonista del receptor beta-2 adrenérgico.

(28/02/2018) Un compuesto seleccionado del grupo que consiste en: 4-(((R)-2-Hidroxi-2-(8-hidroxi-2-oxo-1,2-dihidroquinolin-5-il)etil)amino)butil 1-(4-((3-((S)-fenil((((R)- quinuclidin-3-iloxi)carbonil)amino)metil)fenoxi)metil)benzoil)piperidina-4-carboxilato; (S)-4-(((R)-2-Hidroxi-2-(8-hidroxi-2-oxo-1,2-dihidroquinolin-5-il)etil)amino)butil 2-(4-((3-((S)-fenil((((R)- quinuclidin -3-iloxi)carbonil)amino)metil)fenoxi)metil)benzamido)propanoato; (S)-4-(((R)-2-Hidroxi-2-(8-hidroxi-2-oxo-1,2-dihidroquinolin-5-il)etil)amino)butil 3-metil-2-(4-((3-((S)- fenil((((R)-quinuclidin-3-iloxi)carbonil)amino)metil)fenoxi)metil)benzamido)butanoato; (S)-4-(((R)-2-Hidroxi-2-(8-hidroxi-2-oxo-1,2-dihidroquinolin-5-il)etil)amino)butil…

Formulación de polvo seco que comprende un inhibidor de fosfodiesterasa.

(21/02/2018) Una formulación de polvo seco inhalable que comprende partículas micronizadas de un compuesto de fórmula general (I) como enantiómero , **(Ver fórmula)** en la que: n es 0 o 1; R1 y R2 pueden ser iguales o diferentes, y se seleccionan del grupo que consiste en: - alquiloC1-C6 lineal o ramificado, opcionalmente sustituido con uno o más átomos de halógeno; - OR3 en el que R3 es un alquiloC1-C6 lineal o ramificado opcionalmente sustituido con uno o más átomos de halógeno o grupos cicloalquilo C3-C7; y - HNSO2R4 en el que R4 es un alquiloC1-C4 lineal o ramificado opcionalmente sustituido con uno o más átomos de halógeno, en la que al menos uno de R1 y R2 es HNSO2R4; y partículas portadoras gruesas producidas de un material fisiológicamente aceptable farmacológicamente inerte que tiene un diámetro de masa de…

Procedimiento para proporcionar partículas con cargas electrostáticas reducidas.

Sección de la CIP Necesidades corrientes de la vida

(03/01/2018). Inventor/es: MUSA, ROSSELLA, COCCONI,DANIELA. Clasificación: A61K9/00.

Un procedimiento de preparación de partículas de vehículo para una formulación de polvo seco para inhalación que comprende i) una fracción de partículas comicronizadas constituidas por una mezcla de un excipiente y un aditivo, teniendo la mezcla una mediana de diámetro en masa (MDM) inferior a 20 micrómetros; ii) una fracción de partículas de excipiente gruesas que tiene una MDM igual o superior a 80 micrómetros, comprendiendo dicho procedimiento las siguientes etapas: a) comicronizar las partículas de excipiente y las partículas de aditivo; b) añadir y mezclar las partículas comicronizadas obtenidas con las partículas de excipiente gruesas; caracterizado porque las partículas comicronizadas de la etapa a) se acondicionan en primer lugar por la exposición a una humedad relativa del 50-75 % a 22 ± 2 ºC durante un tiempo comprendido entre 24 y 60 horas.

PDF original: ES-2658179_T3.pdf

Derivados de alcoholes 1-fenil-2-piridinil-alquílicos como inhibidores de fosfodiesterasa.

(08/11/2017) Una formulación en polvo inhalable que comprende un compuesto de fórmula general (II)**Fórmula** en donde: Z se selecciona del grupo que consiste en (CH2)m en donde m ≥ 0, 1 o 2; y CR4R5 en donde R4 se selecciona independientemente de H o un alquilo (de 1 a 4 átomos de carbono) lineal o ramificado opcionalmente sustituido por uno o más átomos de halógeno o por un cicloalquilo (de 1 a 4 átomos de carbono), y R5 se selecciona independientemente del grupo que consiste en - alquilo (de 1 a 4 átomos de carbono) lineal o ramificado, opcionalmente sustituido por uno o más átomos de halógeno; - fenilo; - bencilo; …

Proceso para la producción y purificación de alfa-manosidasa lisosómica recombinante.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(01/11/2017). Inventor/es: NILSSON, STEFAN, FOGH, JENS, ANDERSSON, CLAES, WEIGELT,CECILIA, HYDÉN,PIA, REUTERWALL,HELENA. Clasificación: C07K1/16, A61K38/46.

Un proceso para la purificación de alfa-manosidasa lisosómica humana recombinante de un cultivo celular, en donde se somete una fracción de dicho cultivo celular que comprende alfa-manosidasa lisosómica humana recombinante a cromatografía sobre una resina que contiene un ligando multimodo, en donde dicho ligando multimodo unido a la resina es una sustancia que tiene un grupo ácido carboxílico o ácido sulfónico.

PDF original: ES-2652330_T3.pdf

Tensioactivos pulmonares reconstituidos.

(27/09/2017) Un tensioactivo reconstituido que comprende: una mezcla de fosfolípidos; un polipéptido análogo de la proteína tensioactiva nativa SP-B; y un polipéptido análogo de la proteína tensioactiva nativa SP-C representada por la fórmula general: IPSSPVHLKRLKLLLLLLLLILLLILGALLΩpGpLp (I) en la que: Ω es un aminoácido seleccionado del grupo que consiste en M o M oxidado sobre el átomo de azufre, I, L, y nL (norLeucina); p es 0 o 1 dicha mezcla de fosfolípidos comprendiendo: i) una cantidad de 50% en peso de DPPC; ii) una cantidad de 10% en peso de POPG; y iii) una cantidad de 40% en peso de una…

Formulación farmacéutica que comprende un inhibidor de fosfodiesterasa.

Sección de la CIP Necesidades corrientes de la vida

(14/06/2017). Inventor/es: BONELLI,SAURO, ZAMBELLI,ENRICO, LOSI,ELENA. Clasificación: A61K31/44, A61K9/00, A61P11/06.

Una formulación farmacéutica para administración en aerosol que comprende el enantiómero de un compuesto de la fórmula general (I)**Fórmula** en la que: n es 0 o 1; R1 y R2 pueden ser iguales o diferentes, y son seleccionados de entre el grupo consistente en: - alquilo (C1-C6) lineal o ramificado, opcionalmente sustituido por uno o más átomos de halógeno; - OR3 en el que R3 es un alquilo (C1-C6) lineal o ramificado opcionalmente sustituido con uno o más átomos de halógeno o grupos cicloalquilo (C3-C7); y - HNSO2R4 en el que R4 es un alquilo (C1-C4) lineal o ramificado opcionalmente sustituido con uno o más átomos de halógeno, en el que por lo menos uno de R1 y R2 es HNSO2R4, un propelente y polivinil pirrolidona como un tensioactivo.

PDF original: ES-2628891_T3.pdf

Nuevos compuestos.

(19/04/2017) Un compuesto seleccionado del grupo que consiste en Bromuro de 1-(2-{5-ciano-2-[(R)-6-metoxicarbonil-7-metil-3-oxo-8-(3-trifluorometilfenil)-2,3,5,8-tetrahidro- [1,2,4]triazolo[4,3a]pirimidin-5-il]-fenil}-etil)-4-metoxi-piridinio; Bromuro de 1-(2-{5-ciano-2-[(R)-6-metoxicarbonil-7-metil-3-oxo-8-(3-trifluorometilfenil)-2,3,5,8-tetrahidro- [1,2,4]triazolo[4,3-a]pirimidin-5-il]-fenil}-etil)-3-hidroxi-piridinio; Bromuro de 1-(2-{5-ciano-2-[(R)-6-metoxicarbonil-7-metil-3-oxo-8-(3-trifluorometilfenil)-2,3,5,8-tetrahidro- [1,2,4]triazolo[4,3-a]pirimidin-5-il]-fenil}-etil)-2-metilpiridinio; Bromuro de 1-(2-{5-ciano-2-[(R)-6-metoxicarbonil-7-metil-3-oxo-8-(3-trifluorometilfenil)-2,3,5,8-tetrahidro- [1,2,4]triazolo[4,3-a]pirimidin-5-il]-fenil}-etil)-4-hidroximetil-piridinio; Bromuro de 1-(2-{5-ciano-2-[(R)-6-metoxicarbonil-7-metil-3-oxo-8-(3-trifluorometilfenil)-2,3,5,8-tetrahidro-…

Composición tensioactiva reconstituida mejorada que contiene análogos de proteína tensioactiva B (SP-B) y proteína tensioactiva C (SP-C).

(11/01/2017) Una composición de tensioactivo reconstituido que comprende: a) de 1,2 a 1,8 % en peso de un análogo polipeptídico de la proteína tensioactiva SP-C nativa que consiste en la secuencia representada por la fórmula IPSSPVHLKRLKLLLLLLLLILLLILGALLLGL (SEQ ID NO: 1); b) de 0,1 a 0,5 % en peso de un análogo polipeptídico de la proteína tensioactiva SP-B nativa que consiste en la secuencia representada por la fórmula CWLCRALIKRIQALIPKGGRLLPQLVCRLVLRCS (SEQ ID NO: 2); c) un fosfolípido monoinsaturado y un fosfolípido saturado en una relación en peso que oscila entre 45:55 a 55:45; en el que dicho fosfolípido monoinsaturado se selecciona entre el grupo…

Sistema para la administración de un tensioactivo pulmonar por atomización.

(14/12/2016) Un sistema para administrar un medicamento a pacientes que respiran espontáneamente, que comprende: - i) un catéter flexible adaptado para alcanzar la región retro-faríngea del paciente, el catéter que incluye al menos un primer canal que está adaptado para transportar en la región faríngea del paciente un flujo de medicamento líquido y al menos un segundo canal adaptado para transportar en la región faríngea del paciente un flujo de gas presurizado, - ii) primer medio de bombeo conectado a un primer extremo del al menos primer canal , adaptado para crear una presión baja que empuja la columna del medicamento líquido hacia el segundo extremo del al menos primer canal ; - iii) segundo medio de bombeo conectado al primer extremo del al menos segundo canal , adaptado para crear el flujo de gas presurizado; de modo que cuando…

Composición en solución para aerosol estable presurizada de una combinación de bromuro de glicopirronio y formoterol.

Secciones de la CIP Necesidades corrientes de la vida Técnicas industriales diversas y transportes

(30/11/2016). Inventor/es: DAGLI ALBERI,MASSIMILIANO, BONELLI,SAURO, ZAMBELLI,ENRICO, USBERTI,FRANCESCA, COPELLI,DIEGO. Clasificación: A61M15/00, A61K31/40, A61K9/00, A61K31/573, A61K31/167, A61K47/10, A61K45/06, A61K47/02, B65D83/14, A61M39/22, A61K47/08, A61K45/08, A61K47/06, B65D83/54, A61K31/537.

Una composición farmacéutica en solución para aerosol, para su uso en un inhalador presurizado de dosis medida que comprende: (a) bromuro de glicopirronio a una dosificación en el intervalo de 5 a 26 μg por accionamiento; (b) formoterol, o una sal del mismo o un solvato de dicha sal, a una dosificación en el intervalo de 1 a 25 μg por accionamiento; (c) un propelente de HFA; (d) un cosolvente; (e) una cantidad estabilizante de un ácido mineral; dicha composición está contenida en una lata de aerosol provista con una válvula dosificadora que tiene al menos una junta de caucho butílico.

PDF original: ES-2666905_T4.pdf

PDF original: ES-2666905_T3.pdf

Un procedimiento de administración de un tensioactivo pulmonar.

Sección de la CIP Necesidades corrientes de la vida

(30/11/2016). Inventor/es: CHIESI, PAOLO, GOPEL, WOLFGANG, HERTING,EGBERT. Clasificación: A61P11/00, A61K35/42.

Un kit para su uso en la prevención y/o tratamiento de un síndrome disneico que comprende: a) una composición farmacéutica que comprende de 40 a 80 mg/ml de un tensioactivo pulmonar suspendido en no más de 3,0 ml de un medio acuoso farmacéuticamente aceptable en una forma de dosificación unitaria, teniendo dicha composición una viscosidad inferior a 20 mPas; b) una sonda fina que tiene un diámetro de Fr; c) una jeringa para administrar el tensioactivo a una tasa controlada con un volumen muerto menor de 0,5 ml; y d) medios de envase para contener la forma de dosificación, la sonda fina y la jeringa.

PDF original: ES-2616727_T3.pdf

Inhibidores de cinasa.

(26/10/2016) Un compuesto de fórmula (I) o una sal farmacéuticamente aceptable del mismo: en la que; W es NH; Y es O; R1 es un grupo seleccionado entre (IIa) - (IIc):**Fórmula** cada uno de R8 y R9 es independientemente hidrógeno o alquilo C1-C6, o R8 y R9 pueden formar junto con el átomo de nitrógeno al que están unidos un sistema anular monocíclico saturado o bicíclico condensado o espiro de 5-11 miembros opcionalmente que contiene un heteroátomo adicional que es oxígeno o nitrógeno, estando dicho átomo de nitrógeno opcionalmente sustituido con alquilo C1-C6; en los que dichos grupos alquilo C1-C6 pueden estar opcionalmente sustituidos con un grupo alquilo C1-C6, cicloalquilo C3-C6, hidroxilo o halo; …

Formulación de suspensión mejorada de dipropionato de beclometasona para administración mediante inhalación.

(26/10/2016) Una formulación farmacéutica estéril sin propulsor para su uso en la prevención y/o tratamiento de una enfermedad respiratoria seleccionada de asma y enfermedad pulmonar obstructiva crónica mediante nebulización en los pulmones, comprendiendo dicha formulación partículas micronizadas de monohidrato de dipropionato de beclometasona en suspensión en una solución acuosa a una concentración de 0,04 % p / v, en la que i) no más de 10 % de dichas partículas en suspensión tiene un diámetro en volumen [d(v, 0,1)] menor que 0,7 micrómetros, ii) no más de 50 % de dichas partículas tiene un diámetro en volumen [d(v, 0,5)] comprendido entre 1,6 micrómetros y 1,9 micrómetros; y iii) al menos 90 % de dichas…

Derivados de heteroarilo para el tratamiento de enfermedades respiratorias.

(12/10/2016) Un compuesto de fórmula general (I)**Fórmula** en donde cada R1 es hidrógeno o se selecciona independientemente en el grupo que consiste en: halógeno, (C1-C4) alquilo, (C1-C4) alcoxi, (C1-C4) haloalquilo, hidroxi, -SO2NR6R7, -CN, -NR8SO2R9, -NR6R7, -CONR6R7 y -NR8COR9 y en donde dicho (C1-C4) alquilo está opcionalmente sustituido con uno o más grupos seleccionados de (C3-C7) cicloalquilo, hidroxi y -NR6R7 y en donde dicho (C1-C4) alcoxi está opcionalmente sustituido con uno o más halógenos o grupos (C3-C7) cicloalquilo en donde, R6 es hidrógeno o (C1-C6) alquilo; R7 es hidrógeno o (C1-C6) alquilo; …

Composiciones antibacteriana para el tratamiento de infecciones de las vías aéreas superiores e inferiores.

Sección de la CIP Necesidades corrientes de la vida

(31/08/2016). Inventor/es: PATTINI,Patrizia. Clasificación: A61P11/00, A61K9/08, A61K31/14, A61K31/7024.

Formulaciones de inhalación en ampollas monodosis estériles de solución hipertónica al 5-7 % que contienen ácido hialurónico o una sal o éster del mismo con un peso molecular bajo o un peso molecular intermedio a una concentración de entre el 0,01 % y el 1 %.

PDF original: ES-2604212_T3.pdf

Procedimiento para la preparación de formulaciones farmacéuticas para inhalación, que comprenden un ingrediente activo con alta fuerza de dosificación.

Secciones de la CIP Necesidades corrientes de la vida Técnicas industriales diversas y transportes

(17/08/2016). Inventor/es: CAFIERO,CLAUDIO, TOSINI,FEDERICO. Clasificación: A61K9/14, B01F13/00, B01F15/02, B01F9/00, B01F3/18, A61J3/02, B01F3/20, B02C17/02.

Un proceso para dispersar un ingrediente activo cohesivo micronizado de alta fuerza de dosificación, en formulaciones secas en polvo que comprenden partículas de vehículo, donde dicho proceso comprende los pasos de: (i) suministro de una cápsula de dispersión que comprende una cámara cilíndrica con una frontera lateral hecha de una malla de cribado, donde dicha cámara contiene bolas de molienda, está cerrada por una tapa de rosca en la parte superior, dos barras longitudinales, y un disco en el que la cápsula está conectada con dicho disco mediante dichas dos barras longitudinales; (ii) carga de dicho ingrediente activo y una alícuota de las partículas de vehículo en la cápsula del paso (i); (iii) ajuste de dicha cápsula a un tambor, lleno con la parte remanente del vehículo; (iv) inserción del tambor dentro de un aparato mezclador de cuerpo rotativo; y (v) operación de dicho mezclador de cuerpo rotativo para mezclar la totalidad del polvo.

PDF original: ES-2658403_T3.pdf

Mantenimiento de la inhibición plaquetaria durante una terapia antiplaquetaria.

Sección de la CIP Necesidades corrientes de la vida

(03/08/2016). Inventor/es: CHEN,LISA RUDERMAN, SKERJANEC,SIMONA, BELL,DAWN, STEINHUBL,STEVEN. Clasificación: A61P9/00.

Un inhibidor de P2Y12 de acción corta, reversible para su uso en un método para inhibir al menos parcialmente las actividades plaquetarias en un sujeto tratado previamente con al menos una tienopiridina, en el que el tratamiento con al menos una tienopiridina se interrumpe antes de la administración del inhibidor de P2Y12 de acción corta, reversible, en el que el inhibidor de P2Y12 de acción corta, reversible es cangrelor y se administra al sujeto hasta 5 días antes de que se realice un procedimiento invasivo en el sujeto o durante un procedimiento invasivo que se realiza en el sujeto.

PDF original: ES-2601524_T3.pdf

Uso de una composición que comprende formoterol y dipropionato de beclometasona para el tratamiento de una exacerbación de asma.

Sección de la CIP Necesidades corrientes de la vida

(23/03/2016). Inventor/es: CHIESI, PAOLO, ACERBI, DANIELA, RONDELLI,IVANO, POLI,GIANLUIGI. Clasificación: A61K31/167, A61P11/06, A61K31/57.

Uso de una composición que comprende una combinación fija de a) formoterol, una sal o solvato farmacéuticamente aceptable del mismo o un solvato de dicha sal; y b) dipropionato de beclometasona; para la fabricación de un medicamento administrado por inhalación por medio de un inhalador de polvo seco, formulada en forma de una composición en polvo seco que comprende uno o más diluyentes o vehículos adecuados, o mediante un inhalador dosificador presurizado, en el que ambos principios activos (a) y (b) se disuelven completamente en una mezcla propulsora líquida, para su uso en el tratamiento de rescate de episodios agudos de ataques asmáticos, en caso necesario, como complemento al tratamiento de mantenimiento del asma con el mismo medicamento.

PDF original: ES-2568497_T3.pdf

1 · · 3 · 4 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015