Análogos de interferón.

Análogo de interferón gamma (IFNγ), donde la fracción que media la unión a su receptor natural está al menos funcionalmente interrumpida y donde el análogo comprende una fracción de señalización capaz de mediar la actividad de IFNγ

intracelular, donde la fracción de señalización comprende en el extremo C-terminal del análogo una secuencia seleccionada del grupo que consiste en:

(a) la secuencia de aminoácidos KFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSR;

(b) la secuencia de aminoácidos YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQ;

(c) una secuencia de aminoácidos que muestra al menos 90% de identidad con (a) o (b) siempre que la actividad de señalización intracelular se mantenga;

(d) la secuencia de aminoácidos (a) o (b) donde como mucho residuos de aminoácidos son eliminados, adicionados o sustituidos, siempre que la actividad de señalización, por ejemplo translocación nuclear, se mantenga;

(e) la secuencia de consenso

Vxxxx[V/I]Q[R/H][Q/K]A[F/V/I][N/H]ELI[R/Q] Vx[H/A][Q/E]L[L/S]P[E/A][S/A][S/A][L/K]xxKRKRS donde x es cualquier residuo de aminoácido; y

(f) la secuencia Xaa1Xaa2Xaa3Xaa4 Val Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Gln Xaa10 Xaa11 Ala Xaa12 Xaa13 Glu Leu Ile Xaa14 Val Xaa15 Xaa16 Xaa17 Leu Xaa18 Pro Xaa19 Xaa20 Xaa21 Xaa22 Xaa23Lys Arg Lys Arg Ser Xaa24 Xaa25, donde Xaa1, Xaa2, Xaa3 Xaa4 Xaa6 Xaa11, Xaa13, Xaa14, Xaa16 Xaa17, Xaa18 Xaa19 Xaa20 Xaa21 Xaa22 Xaa23 Xaa24 y Xaa25 es cualquier residuo de aminoácido Xaa5 es Asn o Thr

Xaa7 es Pro o Leu

Xaa8 es Gln o Asn

Xaa9 Val, Ile o Leu

Xaa10 es Arg, His o Lys

Xaa12 es Phe, Val o Ile

Xaa15 es Val, Ile o Met

dicha fracción de señalización está provista en su N-término, opcionalmente vía un enlazador, con al menos un dominio de selección capaz de unión a un receptor de superficie celular diferente del receptor de IFNγ, donde dicho dominio de selección puede enlazar con el receptor de PDGFß, el receptor de manosa6-fosfato/factor- II de crecimiento tipo insulina (M6P/ IGF2R), el receptor de asialoglicoproteína (ASGP) o el receptor de manosa (CD 206).

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/NL2010/050897.

Solicitante: Biorion Technologies B.V.

Inventor/es: POELSTRA, KLAAS, PRAKASH,JAI, BELJAARS,ELEONORA, BANSAL,RUCHI.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/12 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00). › Péptidos cíclicos.
  • A61K38/21 A61K 38/00 […] › Interferones.
  • A61P1/16 A61 […] › A61P ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS O DE PREPARACIONES MEDICINALES.A61P 1/00 Medicamentos para el tratamiento de trastornos del tracto alimentario o del aparato digestivo. › para el tratamiento de trastornos de la vesícula biliar o del hígado, p.ej.protectores hepáticos, colagogos, litolíticos.
  • A61P11/00 A61P […] › Medicamentos para el tratamiento de trastornos del aparato respiratorio.
  • A61P31/12 A61P […] › A61P 31/00 Antiinfecciosos, es decir antibióticos, antisépticos, quimioterápicos. › Antivirales.
  • A61P35/00 A61P […] › Agentes antineoplásicos.
  • A61P37/00 A61P […] › Medicamentos para el tratamiento de problemas inmunológicos o alérgicos.
  • A61P43/00 A61P […] › Medicamentos para usos específicos, no previstos en los grupos A61P 1/00 - A61P 41/00.
  • A61P9/10 A61P […] › A61P 9/00 Medicamentos para el tratamiento de trastornos en el aparato cardiovascular. › para enfermedades isquémicas o ateroscleróticas; p.ej. medicamentos antianginosos, vasodilatadores coronarios,medicamentos para el tratamiento del infarto de miocardio, de la retinopatía, de la insuficiencia cerebrovascular, de la arterioesclerosis renal.
  • C07K14/57 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › IFN gamma.
  • C07K5/00 C07K […] › Péptidos con hasta cuatro aminoácidos en una secuencia totalmente determinada; Sus derivados.

PDF original: ES-2588436_T3.pdf

 

Patentes similares o relacionadas:

Compuestos y composiciones para inhibir la actividad de SHP2, del 8 de Mayo de 2019, de NOVARTIS AG: Un puesto de formula I:**Fórmula** en que: Y1 se selecciona de N, NH y CH; Y2 se selecciona de N, NH y CH; Y3 se selecciona de N y C; Y4 se […]

Imidazolonilquinolinas y su uso como inhibidores de ATM cinasa, del 8 de Mayo de 2019, de MERCK PATENT GMBH: Compuesto de fórmula (IV)**Fórmula** en el que Het1 significa pirazolilo, que puede estar no sustituido o mono-, di- o trisustituido […]

3-Fenil-7-hidroxi-isocumarinas como inhibidores del factor inhibidor de la migración de macrófagos (MIF), del 8 de Mayo de 2019, de The Provost, Fellows, Foundation Scholars, and the other members of Board, of the College of the Holy & Undiv. Trinity of Quee: Un compuesto que tiene la fórmula**Fórmula** en la que n es 0; m es 0 a 3; R1 y R4 son iguales o diferentes y se seleccionan independientemente entre el grupo que […]

Composiciones inmunoestimuladoras y métodos de uso de las mismas, del 8 de Mayo de 2019, de MASSACHUSETTS INSTITUTE OF TECHNOLOGY: Un adyuvante de vacuna que comprende una pluralidad de conjugados de unión a albúmina anfífilos que comprende (a) un componente lipídico; (b) un componente […]

Compuestos de (3-(5-cloro-2-hidroxifenil)-1-benzoil-1H-pirazol sustituidos como inhibidores de histona desmetilasa, del 8 de Mayo de 2019, de UNIVERSITY OF UTAH RESEARCH FOUNDATION: Un compuesto seleccionado entre el grupo que consiste en:**Fórmula** o una sal farmacéuticamente aceptable del mismo.

Receptor de antígeno quimérico (CAR) que contiene un dominio de unión a CD19, del 8 de Mayo de 2019, de UCL BUSINESS PLC: Un receptor de antígeno quimérico (CAR) que comprende un dominio de unión a CD19 que comprende a) una región variable de cadena pesada (VH) que tiene regiones determinantes […]

Composición y procedimiento para la administración segura y eficaz de halopiruvato para el tratamiento del cáncer, del 8 de Mayo de 2019, de KoDiscovery, LLC: Composición para uso en el tratamiento del cáncer, que comprende: a) un cóctel tampón que tiene al menos dos azúcares y un tampón; y […]

Inhibidores de la histona desmetilasa, del 8 de Mayo de 2019, de Celgene Quanticel Research, Inc: Un compuesto que tiene la estructura de la Fórmula (II):**Fórmula** o una sal farmacéuticamente aceptable del mismo, en donde: R1 es hidrógeno, halógeno, C5-C18 arilo […]

Otras patentes de la CIP C07K5/00