Anticuerpos anti-CD33 y método para el tratamiento de leucemia mieloide aguda usando los mismos.

Un anticuerpo específico de CD33, que comprende:

(i) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:



una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:**Fórmula**

(ii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por: y

una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:**Fórmula**

(iii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por: y

una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:**Fórmula**

(iv) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:**Fórmula**


una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:**Fórmula**

(v) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:**Fórmula**

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2003/032737.

Solicitante: IMMUNOGEN, INC..

Nacionalidad solicitante: Estados Unidos de América.



Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/395 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53). › Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.
  • A61K39/40 A61K 39/00 […] › bacterianos.
  • A61K39/42 A61K 39/00 […] › virales.
  • A61K39/44 A61K 39/00 […] › Anticuerpos unidos a sus soportes.
  • C07H21/04 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07H AZUCARES; SUS DERIVADOS; NUCLEOSIDOS; NUCLEOTIDOS; ACIDOS NUCLEICOS (derivados de ácidos aldónicos o sacáricos C07C, C07D; ácidos aldónicos, ácidos sacáricos C07C 59/105, C07C 59/285; cianohidrinas C07C 255/16; glicales C07D; compuestos de constitución indeterminada C07G; polisacáridos, sus derivados C08B; ADN o ARN concerniente a la ingeniería genética, vectores, p. ej. plásmidos o su aislamiento, preparación o purificación C12N 15/00; industria del azúcar C13). › C07H 21/00 Compuestos que contienen al menos dos unidades mononucleótido que tienen cada una grupos fosfato o polifosfato distintos unidos a los radicales sacárido de los grupos nucleósido, p. ej. ácidos nucleicos. › con desoxirribosilo como radical sacárido.
  • C07K16/28 C07 […] › C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.
  • C07K16/46 C07K 16/00 […] › Inmoglobulinas híbridas (híbridos de una inmunoglobulina con un péptido distinto de una inmunoglobulina C07K 19/00).
  • C12N15/00 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K).
  • C12N5/06
  • C12N5/16 C12N […] › C12N 5/00 Células no diferenciadas humanas, animales o vegetales, p. ej. líneas celulares; Tejidos; Su cultivo o conservación; Medios de cultivo para este fin (reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00). › Células animales.
  • G01N33/574 SECCION G — FISICA.G01 METROLOGIA; ENSAYOS.G01N INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION DE SUS PROPIEDADES QUIMICAS O FISICAS (procedimientos de medida, de investigación o de análisis diferentes de los ensayos inmunológicos, en los que intervienen enzimas o microorganismos C12M, C12Q). › G01N 33/00 Investigación o análisis de materiales por métodos específicos no cubiertos por los grupos G01N 1/00 - G01N 31/00. › para el cáncer.

PDF original: ES-2539627_T3.pdf


Fragmento de la descripción:

Anticuerpos anti-CD33 y método para el tratamiento de leucemia mieloide aguda usando los mismos Campo de la invención

La presente invención se refiere a anticuerpos que se unen a CD33. Más particularmente, la invención se refiere a anticuerpos anti-CD33, fragmentos y homólogos de dichos anticuerpos, versiones humanizadas y modificadas en superficie de dichos anticuerpos, equivalentes funcionales y versiones mejoradas de dichos anticuerpos, inmunoconjugados y composiciones que comprenden dichos anticuerpos, y los usos de los mismos en aplicaciones de diagnóstico, investigación y terapéuticas.

En otro aspecto, la invención se refiere a un polinucleótido que codifica los anticuerpos, vectores que comprenden los polinucleótidos, células huésped transformadas con polinucleótidos y métodos para producir los anticuerpos.

Antecedentes de la invención

El antígeno de diferenciación de leucocitos CD33 es una glicoproteína transmembrana de 364 aminoácidos con homología de secuencia con miembros de la familia sialoadhesina, incluyendo la glicoproteína asociada a mielina y CD22, así como la sialoadhesina en sí misma (S. Peiper, 22, Leucocyte Typing Vil, White Cell Differentiation, Antigens, Proceedings of the Seventh International Workshop and Conference, Oxford University Press, p. 777).

La expresión de CD33 parece ser altamente específica para el compartimento hematopoyético, con una fuerte expresión por las células precursoras mieloides (S. Peiper, 22). Se expresa por las células progenitoras mieloides tales como CFU-GEMM, CFU-GM, CFU-G y BFU-E, monocitos/macrófagos, precursores de granulocitos tales como promielocitos y mielocitos aunque con expresión disminuida después de maduración y diferenciación, y granulocitos maduros aunque con un nivel bajo de expresión (S. Peiper, 22).

Por el contrario, las células madre hematopoyéticas pluripotentes que dan lugar a "colonias de blastos" in vitro (Leary, A. G. et al., 1987, Blood 69:953) y que inducen cultivos de médula hematopoyéticos a largo plazo (Andrews R. G. et al., 1989, J. Exp. Med. 169:1721; Sutherland, H. J. et al., 1989, Blood 74:1563) parecen carecer de

expresión de CD33.

Aunque la función específica de CD33 no se conoce, su homología con sialoadhesina sugirió un papel en la característica de unión a carbohidrato de la familia lecitina, un papel confirmado posteriormente (S. Peiper, 22).

De forma importante, los anticuerpos monoclonales anti-CD33 han mostrado que CD33 es expresado por células clonogénicas de leucemia mielógena aguda (AML) en más del 8 % de los casos humanos (LaRussa, V. F. et al., 1992, Exp. Hematol. 2:442-448).

Debido a la expresión selectiva de CD33, los inmunoconjugados que combinan fármacos citotóxicos con anticuerpos monoclonales que reconocen y se unen específicamente a CD33 se han propuesto para uso en el direccionamiento selectivo a células AML. Se espera que dichas terapias no afecten a las células madre y progenitores hematopoyéticos primitivos. Los innmunoconjugados que utilizan anticuerpos anti-CD33 incluyen inmunoconjugados anti-CD33-ricina que se ha mostrado que son altamente letales para células AML (Roy, D. C. et al., 1991, Blood 77:244; Lambed, J. M. et al., 1991, Biochemistry 3:3234), y aún así respeta a las células madre que apoyan la hematopoyesis normal y la reconstitución hematopoyética (LaRussa, V. F. et al., 1992, Exp. Hematol. 2:442-448).

Los estudios adicionales usando inmunoconjugados han mostrado un direccionamiento rápido de anticuerpos anti- CD33 radiomarcados a células blastos leucémicas en sangre periférica y médula cuando se administran i.v. (Scheinberg, D. A. et al., 1991, J. Clin. Oncol. 9: 478-49; Schwartz, M. A. et al., 1993, J. Clin. Oncol. 11:294-33). La rápida internalización del anticuerpo por la célula diana también se ha observado en estudios in vitro (Tanimot, M. et al., 1989, Leukemia 3: 339-348; Divgi, C. R. et al., 1989, Cáncer Res. Supl. Vol. 3: 44a). La evaluación de un anticuerpo anti-CD33 humanizado conjugado con el potente anticuerpo antitumoral caliqueamicina (Gemtuzumab ozogamicina) en estudios pre-clínicos demostró la muerte específica de células de leucemia en cultivos de células HL-6, xenoinjertos tumorales HL-6 en ratones, y muestras de médula de pacientes con AML (Hamann, P. R. et al., 22, Bioconjugate Chem. 13: 47-58).

Lutz et al.: "Eradication of acute myeloid leukemia tumor xenograft by an anti CD33-DM1 immunoconjugate", PROCEEDINGS OF THE ANNUAL MEETING OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, NUEVA YORK, NY, vol. 43, 1 marzo 22 (22-3-1), página 912, describe que el anticuerpo murino My9-6 conjugado con el fármaco maitansinoide DM1 (My9-6-DM1) muestra una potente toxicidad específica de antígeno frente a xenoinjertos tumorales de leucemia mieloide.

Tomando como base los resultados positivos de estos estudios pre-clínicos, se evaluó Gemtuzumab ozogamicina en estudios clínicos de fase I y II. En los estudios de Fase I, la toxicidad principal observada fue mielosupresión debida a la expresión de CD33 en células progenitoras mieloides (Sievers, E. L. et al. 1999, Blood 93: 3678-3684; Sievers E. L. et al., 21, J. Clin. Oncol. 19: 3244-3254.). Los estudios de Fase II con una dosis de 9 mg/m2 i.v. durante 4 horas, repetida después de 14 días, rindió una proporción de respuesta de 3 %. La aprobación para la

comercialización de Gemtuzumab ozogamicina se concedió por la FDA en mayo 2 con indicación para el tratamiento de pacientes con AML positiva para CD33 en primera recaída que tenían 6 años de edad o más y que no se consideran candidatos para quimioterapia citotóxica. Los informes después de la comercialización han indicado el potencial para toxicidad significativa, especialmente enfermedad venooclusiva (VOD), que ha dado lugar a revisiones de etiquetado e inicio de un programa de vigilancia de los pacientes. Mucha de esta toxicidad puede estar relacionada con el componente de fármaco caliqueamicina, que se ha mostrado que causa hepatotoxicidad en modelos pre-clínicos, y por lo tanto puede no ser un resultado directo del direccionamiento de CD33.

Aunque los resultados discutidos anteriormente sugieren que los inmunoconjugados que comprenden un anticuerpo anti-CD33 y un fármaco citotóxico pueden usarse con éxito en el tratamiento de AML, existe una necesidad de inmunoconjugados que sean tanto seguros como efectivos. La presente invención está dirigida a éstos y otros objetivos importantes.

Resumen de la invención

De acuerdo con esto, es un objeto de la presente invención proporcionar anticuerpos que se unan específicamente a CD33, y que puedan usarse en el tratamiento de AML, como se define en las reivindicaciones adjuntas.

Así, en una primera realización, se proporciona un anticuerpo, o fragmento de unión a epítopo de éste, que tiene la capacidad de unirse a CD33, como se define en las reivindicaciones adjuntas.

En una segunda realización, la descripción se refiere al anticuerpo murino My9-6, que se caracteriza completamente en la presente memoria respecto a las secuencias de aminoácidos de las regiones variables tanto de su cadena ligera como pesada, las secuencias de ADNc de los genes para las regiones variables de cadena ligera y pesada, la identificación de sus CDR (regiones determinantes de la complementariedad), la identificación de sus aminoácidos de superficie, y medios para su expresión en forma recombinante.

En una tercera realización, se proporcionan versiones humanizadas o modificadas en superficie del anticuerpo My9- 6 en el que los residuos expuestos en la superficie del anticuerpo My9-6 o fragmentos de unión a epítopo de éste se reemplazan tanto en las cadenas ligeras como pesadas para asemejarse más a superficies de anticuerpo humano conocidas, como se define en las reivindicaciones adjuntas. Dichos anticuerpos humanizados pueden tener una utilidad incrementada, comparados con My9-6 murino, como agentes terapéuticos o de diagnóstico. Las versiones humanizadas del anticuerpo My9-6 también se caracterizan completamente en la presente memoria respecto a sus secuencias de aminoácidos respectivas de las regiones variables tanto de cadena ligera como pesada, las secuencias de ADN de los genes para las regiones variables de cadena ligera y pesada, la identificación de las CDR, la identificación de sus aminoácidos de superficie, y descripción de un medio para su expresión en forma recombinante.

En una cuarta realización, se proporcionan anticuerpos, como se define en las reivindicaciones adjuntas, o fragmentos de unión a epítopo de éstos, que comprenden al menos una región determinante de la complementariedad que tiene una secuencia de aminoácidos seleccionada del grupo que consiste... [Seguir leyendo]



1. Un anticuerpo específico de CD33, que comprende:

(i) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:



una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:


(ii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:




una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:


(iii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:



una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(iv) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:




una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:


(v) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:

**(Ver fórmula)**


una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(vi) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:




una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(vii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:




una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:


(viii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:



una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(ix) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:



una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(x) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:




una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(xi) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:



una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(xii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:



una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(xiii) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:




una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:





una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:



(xv) una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:




una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:

nivltgspgslavsrgervtmsckssqsvffsssgknylawyggipggspkluywastresg 1 vpdrftgsgsgtdftltissvqpedlaiyychqylssrtfgqgtkleikr.

2. El anticuerpo específico de CD33 de la reivindicación 1, que comprende una región variable de cadena pesada que comprende una secuencia de aminoácidos representada por:

qvqlqqpgaevvkpgasvkmsckasgytftsyyihwikqtpgqglewvgviypgnddisynq kfqgkatltadkssttaymglssltsedsavyycarevrlryfdvwgqgttvtvss (SEQ id

NO: 9},

y una región variable de cadena ligera que comprende una secuencia de aminoácidos representada por:

eivltqspgslavspgervtmsckssqsvffsssqknylawyqqipgqsprlliywastresg 15 VPDRFTGSGSGTDFTLTíSSVQPEDLAIYYCHQYLSSRTFGQGTKLEIKR {SEQ ID NO: 1),

3. Un inmunoconjugado que comprende el anticuerpo de las reivindicaciones 1 ó 2 unido a un fármaco o un profármaco.

4. El inmunoconjugado de la reivindicación 3, en el que dichos fármaco o profármaco se seleccionan del grupo que consiste en un maitansinoide, un taxoide, CC-165, un análogo de CC-165, dolastatina, un análogo de dolastatina,

metotrexato, daunorrubicina, doxorrubicina, vincristina, vinblastina, melfalán, mitomicina C, clorambucilo, caliqueamicina y derivados de éstos.

5. Una composición que comprende el anticuerpo de las reivindicaciones 1 ó 2 y un fármaco o un profármaco.

6. Una composición farmacéutica que comprende el anticuerpo de las reivindicaciones 1 ó 2, o el inmunoconjugado o la composición de las reivindicaciones 3-5, y un agente farmacéuticamente aceptable.

7. Un método in vitro para inhibir el crecimiento de una célula que expresa CD33, comprendiendo el método poner

en contacto dicha célula con el anticuerpo de las reivindicaciones 1 ó 2, el inmunoconjugado de las reivindicaciones 3 ó 4, la composición de la reivindicación 5 o una composición farmacéutica de la reivindicación 6.

8. El anticuerpo de las reivindicaciones 1 ó 2, el inmunoconjugado de las reivindicaciones 3 ó 4, la composición de la reivindicación 5 o la composición farmacéutica de la reivindicación 6 para uso como medicamento.

9. El uso del anticuerpo de las reivindicaciones 1 ó 2, el inmunoconjugado de las reivindicaciones 3 ó 4, la composición de la reivindicación 5 o la composición farmacéutica de la reivindicación 6 en la fabricación de un medicamento para tratar un cáncer.

1. El anticuerpo de las reivindicaciones 1 ó 2, el inmunoconjugado de las reivindicaciones 3 ó 4, la composición de 5 la reivindicación 5 o la composición farmacéutica de la reivindicación 6, para uso en el tratamiento de cáncer.

11. El uso o el anticuerpo, el inmunoconjugado, la composición o la composición farmacéutica para uso de las reivindicaciones 9 ó 1 en donde dicho cáncer se selecciona del grupo que consiste en leucemia mieloide aguda (AML), leucemia mieloide crónica (CML) y leucemia pro-mielocítica (PML).

12. Un polinucleótido aislado que codifica el anticuerpo de las reivindicaciones 1 ó 2.

13. Un polinucleótido aislado que codifica una cadena ligera y una pesada del anticuerpo de las reivindicaciones 1 ó


14. Un vector recombinante que comprende el polinucleótido de las reivindicaciones 12 ó 13.

15. Una célula huésped transformada con el vector recombinante de la reivindicación 14.

16. Un método para producir un anticuerpo específico de CD33, comprendiendo dicho método (a) cultivar una célula 15 huésped según se reivindica en la reivindicación 15 en condiciones tales que dicha célula huésped expresa el

anticuerpo, y (b) recoger el anticuerpo así expresado.


Patentes similares o relacionadas:

Anticuerpos ANTI-EGFRVIII y usos de los mismos, del 8 de Mayo de 2019, de REGENERON PHARMACEUTICALS, INC.: Un anticuerpo aislado y fragmento de unión a antígeno del mismo que se une específicamente a EGFRvIII humana, en donde el anticuerpo o fragmento del mismo comprende […]

Regiones epítopo de un receptor de tirotropina (TSH), sus usos y anticuerpos para las mismas, del 8 de Mayo de 2019, de RSR LIMITED: Un kit para la detección de autoanticuerpos para un receptor de TSH en una muestra de fluido corporal obtenida de un sujeto que se sospecha que padece, es susceptible […]

Anticuerpos contra el antígeno de células madre específico de la próstata y su uso, del 8 de Mayo de 2019, de GEMoaB Monoclonals GmbH: Un anticuerpo que se une con antígeno de células madre específico de la próstata, en donde - las regiones determinantes de la complementariedad (CDR) de la región variable […]

Interruptores de células T con receptores de antígenos quiméricos y usos de los mismos, del 8 de Mayo de 2019, de THE SCRIPPS RESEARCH INSTITUTE: Interruptor para activar una célula efectora con receptor de antígeno quimérico (CAR-EC), comprendiendo el interruptor: a. un dominio de interacción con receptor de antígeno […]

Anticuerpos anti-CD40 y usos de los mismos, del 8 de Mayo de 2019, de BETH ISRAEL DEACONESS MEDICAL CENTER, INC.: Un anticuerpo humanizado aislado o un fragmento de unión a antígeno del mismo que se une específicamente a CD40, que comprende una región variable de cadena pesada, que […]

Receptor de antígeno quimérico (CAR) que contiene un dominio de unión a CD19, del 8 de Mayo de 2019, de UCL BUSINESS PLC: Un receptor de antígeno quimérico (CAR) que comprende un dominio de unión a CD19 que comprende a) una región variable de cadena pesada (VH) que tiene regiones determinantes […]

Moléculas de unión a antígeno activadoras de linfocitos T biespecíficas, del 8 de Mayo de 2019, de F. HOFFMANN-LA ROCHE AG: Una molécula de unión a antígeno biespecífica activadora de linfocitos T que comprende a) una primera molécula Fab que se une específicamente a un primer antígeno; […]

Anticuerpos que se pueden conjugar mediante la transglutaminasa y conjugados producidos a partir de ellos, del 8 de Mayo de 2019, de BRISTOL-MYERS SQUIBB COMPANY: Un anticuerpo de longitud completa, en el que al menos una cadena pesada tiene una extensión en el extremo C que tiene una secuencia de aminoácidos que […]

Otras patentes de IMMUNOGEN, INC.