Polipéptidos implicados en respuesta inmunitaria.

Molecula de acido nucleico aislada que comprende una secuencia de nucleotidos seleccionada de:

a) la secuencia de nucleotidos expuesta en la figura 12A

(SEQ ID NO: 16);

b) la secuencia de nucle6tidos que codifica para el polipeptido expuesto en la figura 12A (SEQ ID NO: 17) de los residuos 1-302, o de los residuos 19-302, 20-302, 21-302, 22-302, 24-302 6 28-302; o

c) una secuencia de nucleOtidos complementaria a cualquiera de (a) o (b).

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2000/001871.

Solicitante: AMGEN INC..

Nacionalidad solicitante: Estados Unidos de América.

Dirección: ONE AMGEN CENTER DRIVE THOUSAND OAKS, CA 91320-1799 ESTADOS UNIDOS DE AMERICA.

Inventor/es: YOSHINAGA, STEVEN, KIYOSHI.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > A61K39/00 (Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53))
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P35/00 (Agentes antineoplásicos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > A61K48/00 (Preparaciones medicinales que contienen material genético que se introduce en las células del cuerpo vivo para tratar enfermedades genéticas; Terapia génica)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Células no diferenciadas humanas, animales o vegetales,... > C12N5/10 (Células modificadas por introducción de material genético extraño, p. ej. células transformadas por virus)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/705 (Receptores; Antígenos celulares de superficie; Determinantes celulares de superficie)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/28 (contra receptores, antígenos celulares de superficie o determinantes celulares de superficie)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Técnicas de mutación o de ingeniería genética;... > C12N15/09 (Tecnología del ADN recombinante)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de problemas dermatológicos > A61P17/06 (para el tratamiento de la psoriasis)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de trastornos del... > A61P1/04 (para úlceras, gastritis o reflujo esofágico p.ej. antiácidos, inhibidores de la secreción ácida, protectores de la mucosa)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/18 (contra materiales animales o humanos)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > C07K19/00 (Péptidos híbridos (Inmoglobulinas híbridas compuestas   solamente de inmoglobulinas C07K 16/46))
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P43/00 (Medicamentos para usos específicos, no previstos en los grupos A61P 1/00 - A61P 41/00)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > PROCESOS DE FERMENTACION O PROCESOS QUE UTILIZAN... > Preparación de péptidos o de proteínas (proteína... > C12P21/08 (Anticuerpos monoclonales)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/47 (de mamíferos)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > PROCESOS DE MEDIDA, INVESTIGACION O ANALISIS EN LOS... > Procesos de medida, investigación o análisis en... > C12Q1/02 (en los que intervienen microorganismos vivos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P25/00 (Medicamentos para el tratamiento de trastornos del sistema nervioso)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P7/00 (Medicamentos para el tratamiento de trastornos de la sangre o del fluido extracelular)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de problemas inmunológicos... > A61P37/06 (Inmunosupresores, p. ej. medicamentos para el tratamiento del rechazo en injertos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > AGRICULTURA; SILVICULTURA; CRIA; CAZA; CAPTURA; PESCA > CRIA; AVICULTURA, PISCICULTURA, APICULTURA; PESCA;... > Cría u obtención de animales, no prevista en otro... > A01K67/027 (Nuevas razas de vertebrados)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de trastornos del... > A61P3/10 (para la hiperglucemia, p.ej. antidiabéticos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P29/00 (Agentes analgésicos, antipiréticos o antiinflamatorios que no actúan sobre el sistema nervioso central, p. ej. agentes antirreumáticos; Antiinflamatorios no esteroideos (AINEs))
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > C12N15/00 (Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K))
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de problemas inmunológicos... > A61P37/02 (Inmunomoduladores)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Microorganismos, p.ej. protozoos; Composiciones que... > C12N1/19 (modificados por la introducción de material genético extraño)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > A61K38/00 (Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00))
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de problemas inmunológicos... > A61P37/04 (Inmunoestimulantes)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Microorganismos, p.ej. protozoos; Composiciones que... > C12N1/21 (modificados por la introducción de material genético extraño)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Microorganismos, p.ej. protozoos; Composiciones que... > C12N1/15 (modificados por la introducción de material genético extraño)

PDF original: ES-2464156_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Polipeptidos implicados en respuesta innnunitaria

Campo de la invencion

La presente invenciOn se refiere a polipeptidos que estan implicados en la activacion de linfocitos T.

Especificamente, la invencion se refiere a polipeptidos coestimuladores de linfocitos T, a los acidos nucleicos que codifican para los polipeptidos, a vectores de expresión y celulas huespedes para la produccion de los polipeptidos y a composiciones y usos en el tratamiento de enfermedades relacionadas con inmunosupresión y activacion

inmunitaria.

Antecedentes de la invencion

Para la generación de una respuesta inmunitaria de linfocitos T (celulas T) apropiada, deben proporcionarse dos seriales a la celula T por celulas presentadoras de antigeno (CPA) . En primer lugar, debe presentarse un antigeno al receptor de celulas T (TCR) por medio de un complejo mayor de histocompatibilidad (CMH) , en un acontecimiento que determina la especificidad. En segundo lugar, debe suministrarse una serial coestimuladora, independiente de antigeno mediante el acoplamiento de miembros de la familia B7 en la CPA con la proteina CD28 en celulas T. Una

respuesta inmunitaria productiva conduce a proliferaciOn, diferenciacion, expansión clonal y efecto o funcion. En ausencia de la segunda serial coestimuladora, las celulas T experimentan un estado de falta de receptividad especifica de antigeno de larga duracion, denominado anergia.

Las celulas T inician la respuesta inmunitaria, median en funciones efectoras especificas de antigeno y regulan la actividad de otros leucocitos secretando citocinas. El receptor de celulas T (TCR) distingue la celula T de otros linfocitos y puede unirse al antigeno solo cuando se presenta por la CPA dentro del contexto de un CMH. La

actividad funcional de una celula T particular puede correlacionarse con la expresion de antigenos de membrana, tales como CD4 y CD8. Por ejemplo, celulas T CD4+ funcionan generalmente como celulas T auxiliares (quot;helpe () (TH) y estan restringidas por CMH de clase II, mientras que las celulas CD8+ funcionan generalmente como celulas T citotoxicas (TO y estan restringidas por CMH de clase I.

Los polipeptidos coestimuladores de celulas T potentes que se han identificado previamente incluyen los polipeptidos denominados B7.1 (Freeman et al. J. Immunology 143, 2714-2722 (1989) , Freeman et al. Jour. Expt. Med. 174, 625-31 (1991) ) y B7.2 (Freeman etal. Science 262, 909-911 (1993) y Freeman etal. Jour. Expt. Med. 178, 2185-2192 (1993) ) , (o CD80 y CD86, respectivamente) . Estos polipeptidos se expresan de manera o bien inducible o bien constitutiva en diversas CPA y son ligandos unidos a la membrana para CD28 y CTLA-4, respectivamente, en celulas T. CD28 (Aruffo y Seed Proc. Natl. Acad. Sci. 84, 8573-8577 (1987) y Gross et al. J. lmmun. 144. 3201-3210 (1990) ) se expresa en celulas T en reposo y media en una serial coestimuladora positiva.

Se induce la expresion de CTLA-4 (Brunet etal.Nature 328, 267-270 (1987) y Dariavach etal. Eur. Jour. Immun. 18, 1901-1905 (1988) ) tras la activacion de celulas T y regula de manera negativa la serial de CD28, debido a su afinidad de union superior por B7.1 y B7.2. Ratones sin el gen de CTLA-4 presentan niveles drastic, amente altos de

celulas T, puesto que el mecanismo de desactivacion de la serial de proliferacion se ve alterado en ausencia de

CTLA-4. Este fenotipo demuestra claramente el efecto inhibidor principal que tiene la proteina coestimuladora CTLA4 sobre la proliferacion de celulas T. Ratones que carecen de CD28 o 87.1 o B7.2 tienen un fenotipo menos grave, lo que indica que pueden existir rutas alternativas para la coestimulacion de celulas T.

Ha habido un considerable interes en la ruta de CD28/CTLA-4 como medio para regular la proliferaciOn y activacion decelulas T. Una proteina quimerica que contiene la parte extracelular de CTLA-4 fusionada a Fc humano tiene fuertes efectos inmunosupresores y se ha estudiado en una variedad de entornos clinicos. Tambien se han evaluado

anticuerpos frente a proteinas B7.1 y B7.2 para indicaciones similares en el area de la inmunosupresiOn. Anticuerpos anti-CTLA-4 han mostrado utilidad en la promoción de la activacion de celulas T. Ademas, la terapia genica de B7.1 y B7.2 ha mostrado ser muy prometedora en el area de la inmunoterapia contra el cancer.

Hasta ahora, CD28, CTLA-4, B7.1 y B7.2 estan implicadas en una ruta coestimuladora de celulas T individual. Dada

la capacidad de modulacion de una respuesta inmunitaria regulando la coestimulaciOn de celulas T, seria deseable identificar otros miembros de la misma ruta coestimuladora de celulas T o separada que puedan tener propiedades ventajosas en la regulaciOn de la respuesta inmunitaria y fund& de celulas T del huesped.

Por consiguiente, es un objeto de la invencion proporcionar polipeptidos novedosos para la estimulaciOn de la actividad y/o proliferacion de celulas T. Es un objeto adicional de la invenciOn usar los polipeptidos novedosos para la prevenciOn y el tratamiento de trastornos inmunitarios mediados por celulas T.

Sumario de la invencion

Sorprendentemente, se han identificado dos polipeptidos novedosos de una ruta coestimuladora de celulas T. Los polipeptidos representan una pareja de ligando-receptor en una ruta coestimuladora (mica que parece ser distinta de la ruta que consiste en las proteinas previamente descritas CD28, CTLA-4, B7.1 y B7.2. Los polipeptidos se denominan proteina 1 relacionada con CD28, o CRP1, y proteina 1 relacionada con B7, o B7RP1.

La invencion proporciona moleculas de acido nucleic° que codifican para polipeptidos B7RP1 y polipeptidos relacionados.

El contenido de la invencion tambien se refiere a polipeptidos B7RP1 y polipeptidos relacionados.

La invencion se define mediante las reivindicaciones.

Se abarcan por la invencion vectores de expresiOn y celulas huesped para la producción de los polipeptidos, anticuerpos que se unen a polipeptidos B7RP1 y a polipeptidos relacionados y ensayos para detectar la union de B7RP1 y polipeptidos relacionados con B7RP1 a CRP1 y polipeptidos relacionados con CRP1. Tambien se abarcan por la invencion composiciones farmaceuticas que comprenden B7RP1 o polipeptidos relacionados con B7RP1. Tambien se proporcionan metodos para identificar compuestos que interaccionan con B7RP1 asi como ensayos

para determinar si tales compuestos son agonistas o antagonistas de la actividad de B7RP1.

Los polipeptidos CRP1 y B7RP1 estan implicados en la coestimulacion y proliferacion de celulas T. Los polipeptidos CRP1 y B7RP1, agentes de union selectiva de los mismos y agonistas y antagonistas de los mismos, pueden ser utiles para el diagnóstico, la prevencion y el tratamiento de enfermedades relacionadas con el control de respuestas de celulas T.

Los polipeptidos CRP1 y B7RP1, agentes de unión selectiva de los mismos y agonistas y antagonistas de los mismos, pueden ser Utiles para el diagnóstico, la prevencion y el tratamiento de trastornos inmunitarios, para o bien estimular una respuesta inmunitaria insuficiente o bien reducir o inhibir una respuesta inmunitaria exagerada o inapropiada. El trastorno inmunitario puede estar mediado directa o indirectamente por celulas T.

La invencion proporciona el tratamiento, la prevencion o la mejora de un trastorno mediado por celulas T que

comprende administrar a un animal un polipeptido B7RP1. La invencion tambien proporciona un metodo de diagnostic° de un trastorno mediado por celulas T o una susceptibilidad a un trastorno mediado por celulas T en un animal que comprende determinar la presencia o cantidad de expresión de un polipeptido B7RP1; y diagnosticar un trastorno mediado por celulas T... [Seguir leyendo]

 


Reivindicaciones:

1. Molecula de acid° nucleic° aislada que comprende una secuencia de nucleotidos seleccionada de: a) la secuencia de nucleotidos expuesta en la figura 12A (SEQ ID NO: 16) ; b) la secuencia de nucleótidos que codifica para el polipeptido expuesto en la figura 12A (SEQ ID NO: 17)

delos residuos 1-302, o de los residuos 19-302.

2. 302.

2. 302.

2. 302.

2. 302 .

2. 302; o c) una secuencia de nucleOtidos complementaria a cualquiera de (a) o (b) .

2. Molecula de acid° nucleico segOn la reivindicaciOn 1, en la que la secuencia de nucleótidos esta operativamente unida a una secuencia de control de la expresiOn.

3. Celula huesped que comprende la molecula de acid° nucleico segim la reivindicaciOn 2.

4. Celula huesped segOn la reivindicacion 3, que es una celula eucariota.

5. Celula huesped sew:in la reivindicacion 3, que es una celula procariota.

6. Procedimiento para producir un polipeptido codificado por el acid° nucleico segim la reivindicacion 1 6 2 que comprende hacer crecer un cultivo de la celula huesped segun la reivindicacion 3 en un medio de cultivo adecuado y aislar el polipeptido del cultivo.

7. Polipeptido producido mediante el procedimiento sew:in la reivindicacion 6.

8. Polipeptido codificado por la molecula de acid° nucleico segun la reivindicacion 1.

9. Polipeptido aislado que comprende la secuencia de aminoacidos seleccionada de: a) la secuencia de aminoacidos expuesta en la figura 3A (SEQ ID NO: 12) o la figura 12A (SEQ ID NO: 17) ;

b) la secuencia de aminoacidos madura expuesta en la figura 3A (SEQ ID NO: 12) que comprende un extremo amino-terminal maduro en cualquiera de los residuos 19, 20, 21, 22, 24 O 28, o la figura 12A (SEQ ID NO: 17) quo comprende un extremo amino-terminal maduro en cualquiera de los residuos 19, 20, 21, 22, 24 6 28.

10. Anticuerpo o fragmento del mismo, quo se une al polipeptido segOn la reivindicacion 7.

11. Anticuerpo o fragmento del mismo, quo se une al polipeptido segiin la reivindicacion 8.

12. Anticuerpo o fragmento del mismo, que se une al polipeptido segiin la reivindicacion 9.

13. Anticuerpo o fragmento del mismo sew:in la reivindicacion 10, 11 6 12, quo es un anticuerpo monoclonal o fragmento del mismo.

14. Anticuerpo o fragmento del mismo segLin la reivindicacion 10, 11 6 12, que es un anticuerpo humano o fragmentodel mismo.

15. Anticuerpo o fragmento del mismo segun la reivindicacion 10, 11 6 12, que es un anticuerpo humanizado o injertado con CDR o un fragmento del mismo.

16. Anticuerpo o fragmento del mismo segOn la reivindicaciOn 10, que inhibe la union del polipeptido segiin la reivindicacion 7, 8 6 9 al polipeptido maduro expuesto en la figura 13A.

17. Composición que comprende el polipeptido segOn la reivindicacion 7, 8 6 9 y un portador, adyuvante, solubilizante, estabilizador o antioxidante farmaceuticamente aceptable.

18. Polipeptido sew:in la reivindicaciOn 7, 8 6 9, quo se ha modificado quimicamente.

19. Polipeptido segijn la reivindicaciOn 18, quo se ha modificado quimicamente mediante la adicion de uno o mas polimeros solubles en agua.

20. Polipeptido de fusion que comprende el polipeptido segim la reivindicacion 7, 8 6 9 fusionado a una secuencia de aminoacidos heterologa.

21. Polipeptido de fusión segiin la reivindicacion 20, en el quo la secuencia de aminoacidos heterologa es un dominio constante de IgG o fragmento del mismo.

22. Uso de un polipeptido segOn la reivindicacion 7, 8 6 9 para la preparación de un medicamento para tratar,

prevenir o mejorar un trastorno mediado por celulas T.

23. Metodo de diagnostico de un trastorno mediado por celulas T o una susceptibilidad a un trastorno mediado por celulas T en un animal que comprende:

a) determinar la presencia o cantidad de expresiOn del polipeptido segOn la reivindicaciOn 7, 8 6 9; y

b) diagnosticar un trastorno mediado por celulas T o una susceptibilidad a un trastorno mediado por celulas T basandose en la presencia o cantidad de expresiOn del polipeptido.

24. Metodo de identificacion de una molecula de prueba que se une al polipeptido segiin la reivindicacion 7, 8 6 9 que comprende:

a) poner en contacto el polipeptido sew:in la reivindicacion 7, 8 6 9 con una molecula de prueba; y b) determinar el grado de union del polipeptido a la molecula de prueba.

25. Metodo segin la reivindicaciOn 24, que comprende ademas determinar la actividad del polipeptido cuando este unido a la molecula de prueba.

26. Uso de una molecula de acid° nucleico segun la reivindicacion 1 6 2 para la preparación de un medicamento para regular la activacion o proliferaciOn de celulas T en un animal.

27. Mamifero no humano transgenico que comprende la molecula de acido nucleico segOn la reivindicacion 2.

28. Uso de un antagonista para la preparación de un medicamento para suprimir una respuesta inmunitaria en un animal, en el que el antagonista es un anticuerpo o fragmento del mismo que se une al polipeptido segOn la reivindicaciOn 7, 8 6 9.

29. Polipeptido segiin la reivindicacion 7, 8 6 9 para tratar, prevenir o mejorar un trastorno mediado por celulas

T.

30. Molecula de acido nucleico segOn la reivindicacion 1 6 2 para su uso en la regulaciOn de la activacion o proliferacion de celulas T en un animal.

31. Antagonista para suprimir una respuesta inmunitaria en un animal, en el que el antagonista es un anticuerpo o fragmento del mismo que se une al polipeptido segun la reivindicacion 7, 8 6 9.

32. Usoseglin la reivindicacion 28 para el tratamiento de trastornos autoinmunitarios.

33. Antagonista segim la reivindicacion 31 para su uso en el tratamiento de trastornos autoinmunitarios.

34. Usosegiin la reivindicaciOn 32 o antagonista segOn la reivindicaciOn 33, en el que el trastorno autoinmunitario es uno cualquiera de artritis reumatoide, psoriasis, esclerosis mUltiple, diabetes y lupus eritematoso sisternico.

35. Uso de un antagonista para la preparacion de un medicamento para tratar una enfermedad inflamatoria crónica, en el que el antagonista es un anticuerpo o fragmento del mismo que se une al polipeptido segun la reivindicacion 7, 8 6 9.

FIGURA 'IA

AAG CCG TAC TTC TGC COT OTC 77T GTC C

CTAATC

45

XPYFCRV= 7

, L1

5

LO

15

AGA CT? T?A ACA GGA GM ATC MT GOC TCG GCC GAT CAT AGG ATG

90

R I, I GE

INGSADHRM

TTTTCA TTT CAC AAT CGA GOT OTA CAG AT? TCT TGT ANA T

CCT 135

FSFHNGGVOISCKYP 35

40 45

GAG ACT GTC CAG CAG TTA AAA ATG CGA TTG

GAGA GM 180 ETVQQ:LKMRI,

F R Z R E 50

55 60

GTC CtC TGC GM CTC ACC MG ACC MG GOA AGC GGA AM CCC GTG

225 V r CELTKTKG NA V 65 70 75

TCC ATC MG MT CCA ATG CTC TGT CTA TAT CAT G. TCA MG .c

270 S 1 K N

PNLCLYN S N N

85 , 90

AGC GTC T TTC CTA MC MC CCA GAC AGC TCC CAG OGA ACC

315, S VSFF IoNNPDSSQGS 95 100 105

TAT ?AC TTC TOC AGC CTG TCC AT? TTT GAC CCA CC? CC? TTT CAA 360 YYPCSLSIFOPPFFQ 110 115 120

C ACT GCA CGA TAT TTG CAT AT? TAT CAG 40$ S C C V H 1 V S S Q. 125 130 135

CTC TGC TGC CAG CTG MG CTA CCC GTA GOO TG? CCA OCT 450 LCCQLK P II QC & 140 145 150

TTC CT? GTG GTA TA CT? ATC ATC TOG TTT 495 W F 60 165

AAA AC AM T AGTG CAT GAC CC? AA? CAA 540 K K K ' C S S V H 0 PN C 170 175 180

TCT AGA CTT 585

TAC MG TTC MG GCG GCA GTC MC ACA MC AAA MG FKAAVNTNKKSRL

Y M 185

190 195

600

GCA GGT GTG ACC TCA AGVTS 200

FIGURA 2A

.TG CAG CTA AAG TO? CCC TOT TT? GTG TCC -TG =A

ACC AGO CAG

MQLKCPCF'VSLGTRQ 5

10

1$

CC? OTT TOO AAG MG CTC CAT OTT TCT AGC GGG TTC

TOT GOT 90 PvWXKLNySsGir_

A-0 20 25

30

CT? GGT CTG TTC TTO CTO

AGO GCC1= 135

GI. P t.t

ss T, C

AAS 35 40 45

GCA GAG ACT GM OTC ATO 0 GGC AGO MT GTO GTG CTC 180 AETEV MVOS N V V L

SO 55 60

AGO TGC AT? GAO CCC CAC AGA CGC CAT TTC MC CTG 225 S CIDPHAREFN

L 6.

70. 75

TAT GTC TAT TOG CAA ATC GM MC CCA GAA OTT 'MG GTG ACT TAO 270

YVYWQIE N PEVSVTY SO 85 90

TAO CCT TAC MG TOT CCA 000 ATO AAT GTG GAO AG? TOO TAO 315 Y t FYKSP G I NVDS V 95 100 105

MG MC AGO 00C CAT CTG TOO CTO GAO TOO ATO MG CAG MC 360 K N A GHLSLOSNKQ 110 115 120

TTC DC? CTG TAO CTO AAO AT OTC ACC COD CAG GAT ACC CAG GAG 405 F S L Y L K N VTPQDTQE 125 130 135

TTC ACA TOO COG GTA ITT ATO MT ACA GCC ACA GAO TTA OTC MG 450 FTCAVFMNTATELVK

140 145 150

TTO GM GAO OTC GTC AGO CTG COT GTG 00k GCA MC TTC AG? 495 LEEVVEL'AV A A N r S 155 160 165

ACA CC? GTC ATC AGO ACC TOT GAT AGO TCC MC CCO GM 540

• TPVISTSDSSNP 170 175 180

CC? ACC TAO ACC TOO ATG TCC MG AAT 00C TAO CCh GAG CCC MC 585 ATYTCNSKNOYPEPN

, 190 195

185

CTO TAT TOG ATC MC ACA ACt GAO MT AGO CTA ATA GAO ACG GOT YWINTTONSLIOTA

L 200

205 210

MC ACT OTC TAO TTG MC MG ?TO GGC CTO TA GAT 675

CTO CAG AAT ONNTVYLNKLO 4170

L 215

220 225

GTA ATC AGO ACA TTA AGO CTC CC? TOG ACA TO? COD COG GAT OTT 720

ISTLRLPWISRO'D V

235 240

230

FIGURA 2A (Continuacion)

CC TGC TGC GTA GAG MT GTG GC? CTC CAC CAG AAC ATC ACT AGC

7

LCCV E

NVA'LHQNITS 245 250

255

AT?AGCCAG GCAGAA ACT TTCACT GGAAATMCACAMGMCCCA alo I SQA .S S FTGNNTKN P 260 265

270

CAGGA? ACCCACMTMTGAGTTAAAAGTCCTTGTCCCCGTC CDT QETHNN ELKVLVPY4 275 280 285

GCT GTA CTG CCC GCA GCG GCA TCC TTC ATC ATA TAC ACA 900 AAPVSF Ijyg

A 290 295 300

CGC ACG CGTCCCCACCGAAGCTATACAGGACCCMGACTGTACAG 945 RTRPHRSYTGPKTV .Q 305

310 315

966

CTT GAA ACA GAC CAC GCC

L £ TDH

A 320 322

FIGU

ATG COG CTG GGC AGT CCT OGA CTG CC

CTG CTC

MRLGSP 5

CT CA OCT CAT ACT CAG GAG MG GA?. GTC AG?. GCG ATO GTA GGC 90

L_ R A *0 'T *0 •E

X E v R A *M V 0 25

30

AOC GAC GTO OAG CTC AGO TQC OCT TOO CC? GM. GO?. TTT 135 S

OVELSCACPtG 35 40 45

OAT TTA AAT GAT GTT TAO CT?. TAT TOG CAA ACC AG?

TOG AM 180

O

LNDVYVYWOTS S K SO SS 60

ACC GTO GTO ACC TAC CAC ATC CCA CAG MC AGO TOO MC TVVTICHIPQNSS 65 70

GTO GAO CCC TAO COG MC CC?. GCC CTG ATG TO?. COG GCC GGC 270 ✓ 0 A Y R N R A L M S P A 0 SO 85 90

ATG CTG CGG GGC GAO TTG TTC MC GTC ACC CCC 315 II L R 0 0 LFNVTP 95 100 105

MG TTT CAC TOO CTG GTO CTG 360 K FHCLV 110 115 120

CAG GAG GTT AGO 071 GAG CDT ACA AT GTO OCA 405 Q E V S V E VT H V A 125 130 135

GTO CCC GTC OTC AGO OCC CCC CAC AGO CCC TCC 450 ✓ P V VS A P KS P S 140

145 150

TOO MC GGC TAO CCC 495 TFTC I SINGYP

CAG GAT ACC TTC AGO TOT AT?.

Q

160 165

155

GTG TAO TOG ATC MT AAG ACG GAO Ake AGO CTG CTG $40 VININKTEINSLL 170

175 180

CAC CAG GC? CTG CAG MT GAO ACC GTC TTC TTG MC ADO COG GOC 585 GOAL () ND TVFLUM 0 115 190 195

TTG TAT CAC GTO GTC AGO GTO CTO AGO ATC GCA, COO ACC CCC AGO 630 YDVVSVLRIARTPS

L

201 210

200

MC ATT GOC TOC TGC AT?. GAG AAC GTO CDT CTG CAG MC 675 NIGCCIENVLL ON

GTG

225

220

21$

GAO 720

MT CAC ATC GO?. G TVGSOTONOIGE R 0

CTG ACT GTC GGC AOC CAG ACA GO

L

240

215.

210

FIGURA 3A (Continuacion)

AAG ATC ACA GAG AAT CCA GTC AGT ACC GGC GAG AAA AAC GCG GCC

765 TENPVSTGEKNAA 245 250 255

ACG TG C ACC ATC CTG GCT GTC CTG TGC CTG CT? GTG GTC GTG GCG

910 TWSTr.AVLC_LLVVVA 260 265 270

GTG GCC ATA GGC TGG GTG TGC AGG GAC CGA TGC CTC CAA CAC AGC 855 VAIGWVCRORCLQRS 275 280 2e5

TAT GCA GGT Y A G 288

Figura 4A

lisado medio celular condicionado

12, 5 5 10 20/ 1jjanadidos

66

, 04 N

Figura 4B

lisado celular con B7RP1-Fc Vector solo rnedio control medic con B7RP1-Fc

- 97 kD 66 kD 46k0 30 kD

Figura 5 Proteinas de fusion de Fe

Control de Fc B7RP1 CRP1 B7.2 MA-4

Origmales

00 B7RP1 Ululas

CRP1

hCD28

Figura 6

100

io Simulado-Fc

1RP1-Fc JW1104$4.002

Sin tincion Sin tinciOn 011

0

in 1 0

• Gable-of=

37RPI-Fc

Figura 8

JG011499, 004

A

0 200 430

60 40 1000 MGM

Figura 9

Estimulacion con Con A de celulas T reguladas por proteina de fusion B/RP1-Fc

50000

EjSin adiciones

45000 40000

CRP1-Fc 35000

STRP1-Fc

'4=

30000 B7.2-Fc

25000 20000 15000 10000

5000 0 Sin adiciones 0, 33

1 3 10

Con A ( rni)

Figura 10

Gangtio linfatico-control n.° 10 GI. X11 n.° 40 .

piano d GL-control n.°

so. *

47.0

iteo-control n.° 25 fleo-WX11 n.° 32

' •

Figmr812A.

GcTGOTACGCCTGCAGOTACCOOTCCGGAA GGGICGACCC

-138 TCCOCGGOAGCGCAGTTAGAGCCGATCTCCCGOGCCCCGAGGTTGCTC -76 CCGCGGCCCAAOTTCTCCGCGCCCCGAGGTCTCCGCGCCCCGAGGTCTCCGCGGCCC -14 CTCCOCCCOCACC

-1

ATG COG CTO 0Gc AG? CC'? GGA CTO CTC TTC CTO CTC TTC AGC ACC 45

IIRLOSPGLI, FtLp5L_q 5

10 15

ACT GAG MG OAk OTC AGA GCG ATG GTA GGC 90 *T * E X V R A • M 20 25

30

AOC CAC OTG CAC CTC AGC TGC OCT TOO CC? GM GGA AGC COT TT'? 135 SEIVEL S CACP E 0 S S F 35 40 45

GAT TTA MT T OTT 'MC GTA TAT TOG CAA ACC ACT GAG TCG AAA 180

L. N DV YVYWQTS E Sic 50 SS 60

ACC OTC GTO ACC 'MC CAC MC CCA GAG MC AOC TCC TTG GM MC 225 T VVTYR/PQMSS 65 70 75

GTG GAG AGC CGC TIC COG MC CGA GCC CT G ATO TCA CCG GCC GOC 270 ✓ OSRYR N RALMSPAG 80 85 90

ATG CTG COG GAG TTC TCC CTG CCC TTG TTC MC GTC ACC CCC N L R DFSLRLP N V T P 95 100 105

CAG AAG TTT CAC TOC CTG GTG TTG AOC CM TC CTG 360 Q KPMCLVL 110 115 120

GOA TTC GAG GAG CT? TTG AGC OTT GAG OTT ACA CVO CAT GTO GCA 405 G FQSVLSVEVTLHVA 125 130 135

GTG CCC GTC GTC AGC GCC CCC CAC: AGC CCC TCC 450

VPVVSAPHSPS

$

140 145 150

CAO GAT ACC TTC AGO TOT ACA TCC Ath MC CCC TAG CCC 495

TFTCTSI N C V P 155 160 165

OP

AGO CCC MC GTG The TOG ATC MT MG AGO GAG MC AOC CTO 540 RPNVYWINKTDN S Id L 270 175 180

GAG GAG OCT CTG CAG IA'? GAG ACC OTC ITC' TTO MC AIG COG GGC 585

01QALQMOTVPId N M R G

190 198

185

GTG OTC AGC GTO CTO AGO MC GCA C00 ACC eCC AGC 630

TTG TAT VVSVLRIARTPS

It 200

205 210

A TGCTGC ATh GAG MC OTC CTT CTG CAO CAO MC C

C I E NV LLOQN

215 220 225

CTG ACT GTC GGC AGC CAG ACA GGA AAT GAC ATC GGA GAG AGA GAC

720 LTVGEQTG N D I C. E R D 230 235 240

AAG ADC ACA GAG AAT CCA GTC ACT ACC GGC GAG AAA AAC GCG GCC 765 K ITENPV8*TGEKNAA 245 250 255

ACG TGG AGC ATC CTG CC? GTC C 'FCC CTG C GPO GTC GTO GCC 810 TWSILAVLCLLVVVA 260 265 270

GPO GCC ATA GGC TGG GPO 'FCC AGG GAC CGA TGC CTC CAA CAC AGC 855 ✓ A1GWVCRDRCLQHS 275 280 285

TAT GCA GOP GCC TOG CC? GPO ACT CCG GAG ACA GAO CTC ACT GGC 900 Y A G A W A V S P ET E L PG 300

909 H V TERMINACION 302

CAC CT? TGA

CCGGAGCTCACCGCCCAGAGCGTOGACA CCGTGAGACGCCACCGTGAGAGGCCAGG 971 TGGCAGCTTGAGCATGGACTCCCAGACTGCAOGGGAGCACTTGOGGCAGCCCCCAGAAGGAC 1033 CACTGCTGGATCCCAGGGAGAACCTGCTGGCGVTGGCTGTGATCCTGGAATGAGGCCCTTTC 1095

Figura 12B.

set human° ratón Consenso

set humano ratón Consenso

set human° raton Consenso

set humano ['Won Consenso

set human° ratOn Consenso

ser humano ratan Consenso

set humano ratem Consenso

MRLGSP Z -LF-t2.FSS LRADTQEKEV 25 MQLKCPCFVS LGTRQPVWKK LHVSSOFFS0 LGLFL SS LCAASAETEV

M.L.. P.... OOOOO•.•• . ... .. ...GL.LF.LL.SSL.A...E.EV 50

RAMVOSDVEL SCACPEOSRF OLNDVYVYWQ TSESKTVVTY HIPQNSSLEN 75

GAMVGSNVVL SCIDPHRAHF NLSGLYVYWQ /ENPEVSVTY YLPYKSPGIN 100 .AMVOS.V.L .L.. .YVYWQ VTY . .P.. S...N 100

VDSRYRNRAL MSPAGMLRGO FSLRLFNVTP ODEQKFMCLV LSQ-SLGFOE 124 VDSSYKNRGH LSLDSMKQGN FSLYLKNVTP QDTQEFTCRV FMNTATELVX 150 VDS.Y.NR. . .S. ..M..G.FSL.L.NVTPQD.Q.F.C.V .... 150

VLSVEVTLHV AANFSVPVVS APHSPSQ-DE LTFTCTSING YPRPNVYWIN 173

ILEEVVRIAV AANFSTPVIS TSDSSNPGQE RTYTCMSKNO YPEPNLYWIN 200

.L. . .V.L.VAANFS.PV.S . . .S. . . . .E .T.TC.S.NGYP•PN.YWIN 200

KTDNSLLDQA LONDTVFLNM RGLYDVVSVL RIARTPSVNI GCCIENVLLQ 223 TTDNSLIDTA LQNNTVYLNK LGLYDVISTL RLPWTSRODV LCCVENVALH 250 .TDNSL.D.ALQN.TV.LN. .GLYDV.S.LR. . .T. . . . . .CC.ENV.L. 250

ONLTVGSQTG ND/GERDKIT ENPVSTGEKN AATWSILAVL'CLLVVVAVAI 273 ONITSISQAE SFTGNNTKNP QETHNNELKV LV--PVLAVL AAAAFVSFII 298 QN.T..SQ.. ...G... K.. ... ..... K. 300

GWVCRDRCLQ HSYAGAWAVS PETELTGHV 302 YR--RTR-PH RSYTOPKTVQ LE--LTDHA 322

. . . .A.R. . . .SY.G. . . V. .E. .LT.H.

329

Figur

AACAATTTCACACAGGAAACAGCTATGACCATGATTACOCCAAGCTCTAATACGA CTCACTATAGGGAAAGCTGGTACGCCTGCAGOTACCGGTCCGGAATTCCCGGGTC GACCCACQCGTCCOTGAACACTGAACGCGAGGACTOTTAACTGTTTCTGGCAAAC

ATG

MG TCA GGC CTC TGG TAT TTC TTT CTC TTC TGC TTG CQC ATT 45 MKSGLWY P

FLPCt, R,

IS

AAA GTT TTA ACA GGA

AIC MT GGT IC? C MT TAT GAG ATG 90

$ V I% T *G • G S NYES 20

TTT ATA TTT CAC

MC GGA GOT GTA CM AT? TTA TGC AAA. TAT CCT 135 FIFHNGGVOILCXYP 35 40 45

GTC CAS CAA TIT AAA ATG CAG ?TG CTG AAA GGG CAA 180 VQQFX N QLLKG 50

55. 60

ATA CTC ICC GAT CTC ACT MG ACA AAA GGA AG?

ACA GTG 225 CDLTKTKGS T V 65 70

TCC AT? MG AG? CTG AAA TTC TGC CAT TCT CAC TCC MC MC 270 S IKSLKFCHSO S N N 80 OS 90

G IC? TT? CTA, TAC MC GAG CAT TCT CAT GCC MC 315 ✓ $ FLYNLDHSHAN 91 100 105

TAT TAC TTC TGC MC CTA TCA AT? TTT GAT CC? CC? CC? ?TT AAA 360 YYFCN L S IFDPIpppx 110 115 120

GTA ACT CT? ACA OGA GGA TAT TTG CAT Al!? TAT GM TCA CAA CT? 405 ✓ TLTGGYLHIY S Q L 125 130 135

TGT TGC CAG CTG MG CC ATA GOA. T T 450 CCOLK 140 14

GTT GTA GTC TGC AT? TTG ATA CT? AT? TG? ACA 495 9 vv. c TL I L C 155 160 165

AAA MG MG TAT ICA TCC AG? GTG CAC GAG CC? MC GGT GM. TAG 540

KKYSSSVHDPNGEY . 170 175 190

K

C MG AGA GCA GTG MC ACA GCC AAA AAA TO! AGA CTC ACA 585 NHAVNTAKKSRLT

185 190 195

600

GAT GTG ACC CTA MA

D V T Li TERMINACION 199

TATGGAACTCTGGCACCCAGOCATGAAGCACG TCTCAACTTGA 655 AGTGCAAGATTCTCTTATTTCCOGGACCACGGAGAGTCTGAC AACTACATACA 710

TCTTCTGCTGGTGITTTGTTCAATCTGGAAGAATGACTGTATCAGTCAAIGGGGA 765 TTTTRACAGACTGCCTTGGTACTGCCGAGTCCTCTCAAAACAAACACCCTCTTGC 820 AACCAGC1quot;TTGGAGAAAGCCCAGCTCCTGTGTGCTCACTGGGAGTGGAATCCCTG 875 TCTCCACATCTGCTCCTAGCAGTGCATCAGCCAGTAMACAAACACATTTACAAG 930 AAAAATGTTITAAAGATGCCAGGGGTACTGAATCTGCAAAGCAAATGAGCAGCCA 985

AGGACCAGCATCTGTCCGCATTTCACTATCATACTACCTCTTCrITCTGTAGGGA 1040 TGAGAA, TTCCTCTTTTAATCAGTCAAGGGAGATGCTTCAAAGCTGGACCTATTTT 1095 ATTTCTGAGATGTTGATOTGAACTOTACATTAGTACATACTCAGTACTCTCCTTC 1150 AATTGCTGAACCCCAGTTGACCATTTTACCAAGACTITAGATGCTTTCTTGTGCC 1205

Figura 138

hCRP1 MRSOLWYFFLPCLRIKIILTGEINGSANYEmFUHNOGVOILCKYPDIVW SO ii 1.11 1:.111111111.: 11 11111111 1111: III mCRP1 MKPYPCRVFVFCFL/RWITGEINGSADHRMFSPHNGGWISCKYPETVW 50

hCRP1 FINQUiaGQILCUTTiKOSONTVSIKSIAPCHSQ6NNSVSFFLYNLD 100 II.!: :011111111111 1111. 11 1111111111 I 1 mCRP1 LKMRLFREREVLCELTKTICGSONAVSIKNpMLCLYMLSNNVV5FFLNNPD 100

hCRP1 RSHANYYFCNLSIFDPPiTKV.TIATGOiLHIYESQLCTAFWLPIGAA 149 1 .11111111111111. 1.1111111111111111 111:1111 mCRP1 SSOGSYYPCSLSIFDPPPFQERNIASGGYLHIYESQLCCWALWLPVGCAA 150

hCRP1 FVVVCILGCILICW1aKKRYSSSVHDPNGEYKFKRAVNTAKRSRLTDVTL 199 1111 . 11111 1 .1111 1111111 11111 1111 11111 11 mCRP1 FVVVLiFOCILITWFSKICKYOSSVHDPNORYMFMAAVNTNKKORLAGVTO 200

a

en

Expresion de CRP1

Figura 14

A.

80 70 60 50 40 30 20 10 0

14182125293234373942485258

Dias tras la inmunizaciOn

14 18 21 25 29 32 34 37 39 42 48 52 58

Dias tras la inmunizacion

Figura 16

Figura 20

E ec o de B7R101-Fc sobre el crechnlento tumoral de Meth A en ratones Balb-C

Grupo1, 2 iGrupo control (n=8)

2O00, 00 1800, 00 Grupo 341 87RP-1-Fe 1600, 00 - (ngs8) -8 rogilcg

1400, 00 1200, 00 1000, 00

800, 00 600, 00 400, 00 200, 00

0, 00 5 10 15 20 25 30

Dias tras la implantación del tumor

A. Ratan control n.° 53F: Colon prox, 40X B. Ratàn n.° 1 F: Colon prox. 40X

C. Raton n.* 111F: Colon prox. 20X

D. Raton n.° 111F: primer piano de mucosa 100X

F. Raton n.° 112F: macrafagos epltelioides

E. Raton n.° 112F: CoJule gigante, submucosa

Figura 17

capa muscular d

A. Raton control a.° 53F: Colon distal. 40X B. Raton n.° 111F: Colitis distal, 40X

D. Raton n.° 112F: Colon distal, 40X

C. Raton n.° 55M: Colitis distal, 40X

Ratan n.°112: primer piano, 100X

E. Raton n.° 112: Celulas CD3+, 40X

Figura 18

A. Ratón control n.° 53F: duodeno, 40X B. Raten n.° 51F: duodeno, 40X

ia del yeyuno, 40X

C. Raton control n.° 63F: yeyuno, 40X

F. RatOn n.° 231M: Atrofla del Hee, 40x

E. Raton control n.° 53F: Ile°, 40X

Figura 19