Análogos de oxintomodulina.

Un análogo peptídico que comprende la estructura

Z1-P-M-Z2

en la que P es un péptido que tiene la secuencia de aminoácidos

HX1QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9X10

(SEC ID Nº: 110)

en la que X1 es una D-serina, ácido α-aminoisobutírico (aib), resto de ácido 1-amino-1-ciclobutano carboxílico (Acb), ácido 1-amino-1-ciclohexano carboxílico (Acx); ácico alfa-aminobutírico (Abu); ácico D-alfa-aminobutírico (D-Abu); ácido aminovalérico (Nva); beta-ciclopropil-alanina (Cpa); propargilglicina (Prg); alilglicina (Alg); ácido 2-amino-2-ciclohexil-propanoico (2-Cha); D-tercbutilglicina (D-tbg); vinilglicina (Vg); ácido 1-amino-1-ciclopropano carboxílico (Acp); o resto de ácido 1-amino-1-ciclopentano carboxílico (Acpe);

X2 es un resto de tirosina (Y) o de lisina (K);

X3 es un resto de serina (S) o de lisina (K);

X4 es un resto de serina (S), de ácido α-aminoisobutírico (aib), o de ácido glutámico (E);

X5 es un resto de arginina (R) o de ácido glutámico (E);

X6 es un resto de arginina (R) o de alanina (A);

X7 es un resto de glutamina (Q) o de lisina (K);

X8 es un resto de metionina (M), de norleucina (Nle), de sulfóxido de metionina (m), o de O-metil-L-homoserina (o);

X9 es un resto de ácido gamma-glutámico (γGlu);

X10 es un resto de ácido gamma-glutámico (γGlu) o está ausente;

Z1 es un grupo protector presente opcionalmente que, si está presente, está unido al grupo amino de N-terminal, M es (i) un resto de cisteína unido covalentemente a un resto de colesterol mediante un enlazante hidrófilo, (ii) un resto de lisina unido covalentemente a un resto lipídico mediante un espaciador que comprende uno o más restos de ácido gamma-glutámico, o (iii) un resto lipídico, en el que M está unido covalentemente a un aminoácido C-terminal o interno de P mediante un espaciador que comprende uno o más restos de ácido gamma-glutámico; y

Z2 es un grupo protector presente opcionalmente que, si está presente, está unido al grupo carboxilo C-terminal; y sales farmacéuticamente aceptable del mismo.

en el que en análogo peptídico o sal del mismo tiene un pI de menos de 6,0 y es un agonista dual del receptor de GLP-1 y del receptor de glucagón.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2009/068678.

Solicitante: MERCK SHARP & DOHME CORP.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 126 EAST LINCOLN AVENUE RAHWAY, NJ 07065-0907 ESTADOS UNIDOS DE AMERICA.

Inventor/es: PESSI, ANTONELLO, BIANCHI, ELISABETTA, INGALLINELLA, PAOLO, WARD, BRIAN, METZGER,JOSEPH M, CARRINGTON,PAUL E, EIERMANN,GEORGE J, MARSH,DONALD J, POCAI,ALESSANDRO, SINHA ROY,RANABIR, SANTOPRETE,ALESSIA, CAPITO,ELENA, DIMARCHI,RICHARD.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > A61K38/00 (Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00))

PDF original: ES-2524477_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Análogos de oxintomodulina

Referencia cruzada a solicitudes relacionadas La presente solicitud es una continuación en parte de la solicitud internacional de patente Nº PCT/US2009/034448 presentada el 19 de febrero de 2009.

Antecedentes de la invención

(1) Campo de la invención La presente invención se refiere a análogos peptídicos de oxintomodulina (OXM, glucagón-37) , que se han modificado para ser resistentes a la escisión e inactivación por dipeptidil peptidasa IV (DPP-IV) y para aumentar la semivida in vivo del análogo peptídico mientras que se permite al análogo peptídico actuar como un agonista dual del receptor de GLP-1/glucagón (GCGR) , y al uso de dichos análogos peptídicos para el tratamiento de trastornos metabólicos tales como diabetes y obesidad.

(2) Descripción de la técnica relacionada La hormona oxintomodulina (OXM, glucagón-37) es un producto postraduccional del procesamiento de preproglucagón en el intestino y sistema nervioso central (SNC) y se secreta por células L en el intestino en respuesta a la ingesta de comida. Descubierta en 1983, se ha implicado a OXM en la regulación de la ingesta de comida y gasto de energía (Jarrouse y col., Endocrinol. 115: 102-105 (1984) ; Schjoldager y col., Eur. J. Clin. Invest. 18: 499-503 (1988) ) . La administración central o periférica de OXM en ratas causa una disminución de la ingesta de comida a corto plazo con efectos mínimos sobre el vaciado gástrico (Dakin y col. Endocrinology, 142: 4244-4250 (2001) , Dakin y col. Endocrinology, 145: 2687-2695 (2004) ) . La administración intracerebrovascular repetida de OXM en ratas da como resultado temperaturas centrales elevadas y una ganancia de peso reducida en comparación con sus parejas de alimentación, lo que sugiere efectos tanto en la ingesta calórica como en el gasto de energía (Dakin y col. Am. J. Physiol. Endocrinol. Metab., 283: E1173-E1177 (2002) ) .

En estudios relacionados, la administración de OXM inhibió de manera dependiente a la dosis la ingesta de comida tanto rápida inducida como de fase oscura, pero a diferencia de GLP-1, no tuvo efecto sobre el vaciado gástrico, OXM también redujo los niveles de grelina en ayuno y aumentó la inmunorreactividad de c-fos, en el núcleo arqueado (ARC) . La administración IP repetida durante siete días de OXM causó una reducción en la velocidad de ganancia de peso corporal y adiposidad en ratas (véase Dakin y col., Endocrinology, 145: 2687-2695 (2004) ) .

Los estudios de la acción de OXM en ratones han demostrado que aunque OXM puede activar los receptores tanto de glucagón como de GLP-1, las acciones anoréxicas de OXM solo requieren del receptor de GLP-1, ya que OXM icv inhibe la ingesta de comida en ratones knockout para el receptor de glucagón. Sin embargo, los efectos anoréxicos de OXM están completamente ausentes en ratones knockout para el receptor de GLP-1. Además, exendina-4, pero no OXM, regula el gasto de energía en ratones. De este modo, OXM parece ser un antagonista débil en el receptor de GLP-1, cuando se usa en concentraciones farmacológicas (véase Baggio y col., Gastroenterol. 127: 546-58 (2004) ) . También se ha descubierto que OXM mejora la intolerancia a la glucosa en ratones alimentados con una dieta alta en grasas (Dakin y col., Am. J. Physiol. Endocrinol. Metab. 294: E142-E147 (2008) y aumenta el ritmo cardiaco intrínseco en ratones de manera independiente al receptor de GLP-1 (Sowden y col., Am. J. Physiol. Regul. Integr. Comp. Physiol. 292: R962-R970 (2007) . También se ha demostrado que OXM afecta al reclutamiento de beta-arrestina por parte del receptor de GLP-1 y la señalización a través de Galfa (Jorgensen y col., J. Pharma. Exp. Therapeut. 322: 148-154 (2007) ) y que afecta de manera diferencial a la activación neuronal hipotalámica tras la inyección periférica de OXM (Choudhri y col., Biochem. Biophys. Res. Commun. 350: 298-306 (2006) ) .

En seres humanos, una única infusión intravenosa de OXM de 90 minutos en sujetos sanos de peso normal redujo la puntuación de hambre y la ingesta de comida en una comida de buffet en aproximadamente un 19 %. La ingesta calórica acumulativa durante 12 horas se redujo en aproximadamente un 11 % sin comunicación de náuseas o cambios en el sabor de la comida (Cohen y col., J. Clin. Endocrinol. Metab., 88: 4696-4701 (2003) ; Lykkegaard y col., ADA Scientific Sessions, Resumen Nº 1506-P (2003) ) . Más recientemente, inyecciones preprandiales de OXM durante un periodo de cuatro semanas en voluntarios obesos sanos (IMC de aproximadamente 33) condujo a una reducción significativa de ingesta calórica en el primer día de tratamiento (aproximadamente del 25 %) que se mantuvo durante la duración del estudio (un 35 % de reducción después de cuatro semanas) (Wynne y col., Diabetes 54: 2390-2395 (2005) ) . Se observó una fuerte pérdida de peso al final del estudio en los sujetos tratados (1, 9 %, corregida por placebo) . Los niveles en plasma de OXM fueron similares a los observados en el estudio de infusión (pico de concentración de aproximadamente 950 pM) . La ausencia de cualquier taquifilaxia y la baja incidencia de náuseas leves y transitorias (aproximadamente un 3 %) a pesar de las dosis relativamente altas necesitadas debido a la baja estabilidad in vivo de OXM (t1/2 en plasma < 12 minutos) hace que esta hormona sea una de las pocas dianas para la obesidad con validación en seres humanos y un perfil de tolerabilidad atractivo.

OXM tiene una semivida muy corta y se desactiva rápidamente por la peptidil peptidasa IV (DPP-IV) de la superficie

celular (Zhu y col., J. Biol. Chem. 278: 22418-22423 (2002) ) . Sin embargo, los inhibidores de DPP-IV son neutrales para el peso en clínica, lo que sugiere que pueden ser necesarios niveles suprafisiológicos de OXM (900 -1000 pM) para lograr una pérdida de peso en seres humanos. Los análogos peptídicos de OXM para inducir pérdida de peso en seres humanos han sido el objeto de las solicitudes internacionales publicadas con Nº WO 03/022304, WO 2004/062685, y WO 2006/134340.

OXM por lo tanto muestra potencial como tratamiento para trastornos metabólicos, tales como diabetes y obesidad. Sin embargo, debido a la baja estabilidad in vivo de OXM, hay una necesidad de desarrollar análogos de OXM que puedan ser administrados de manera segura y eficaz para el tratamiento de trastornos metabólicos, tales como diabetes y obesidad. Sería además deseable que los análogos o derivados que se desarrollasen se fuesen modificados por conjugación a restos que mejoren la estabilidad y farmacocinética, más particularmente, modificaciones que confieran resistencia a la escisión por DPP-IV. Sería además deseable proporcionar análogos de OXM que sean capaces de actuar como agonistas duales del receptor de GLP-1/receptor de glucagón.

Breve sumario de la invención La presente invención proporciona análogos peptídicos de oxintomodulina (OXM, glucagón-37) , que se han modificado para ser resistentes a la escisión e inactivación por dipeptidil peptidasa IV (DPP-IV) y para aumentar la semivida in vivo del análogo peptídico mientras que se permite al análogo peptídico actuar como un agonista dual del receptor de GLP-1/glucagón (GCGR) , y al uso de dichos análogos peptídicos para el tratamiento de trastornos metabólicos tales como diabetes y obesidad. En particular, los análogos desvelados en el presente documento reducen la ingesta de comida y el peso corporal, aumentan el ritmo metabólico, median la secreción de insulina dependiente de glucosa (SIDG) desde los islotes pancreáticos y mejoran la tolerancia a la glucosa, proporcionando por tanto una opción de tratamientos para individuos afectados por un trastorno metabólico, tal como síndrome metabólico, obesidad, diabetes, síndrome metabólico X, hiperglucemia,... [Seguir leyendo]

 


Reivindicaciones:

1. Un análogo peptídico que comprende la estructura Z1-P-M-Z2

en la que P es un péptido que tiene la secuencia de aminoácidos HX1QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9X10 (SEC ID Nº : 110)

en la que X1 es una D-serina, ácido α-aminoisobutírico (aib) , resto de ácido 1-amino-1-ciclobutano carboxílico (Acb) , ácido 1-amino-1-ciclohexano carboxílico (Acx) ; ácico alfa-aminobutírico (Abu) ; ácico D-alfa-aminobutírico (D-Abu) ; ácido aminovalérico (Nva) ; beta-ciclopropil-alanina (Cpa) ; propargilglicina (Prg) ; alilglicina (Alg) ; ácido 2-amino-2-ciclohexil-propanoico (2-Cha) ; D-tercbutilglicina (D-tbg) ; vinilglicina (Vg) ; ácido 1-amino-1-ciclopropano carboxílico (Acp) ; o resto de ácido 1-amino-1-ciclopentano carboxílico (Acpe) ; X2 es un resto de tirosina (Y) o de lisina (K) ; X3 es un resto de serina (S) o de lisina (K) ; X4 es un resto de serina (S) , de ácido α-aminoisobutírico (aib) , o de ácido glutámico (E) ; X5 es un resto de arginina (R) o de ácido glutámico (E) ; X6 es un resto de arginina (R) o de alanina (A) ; X7 es un resto de glutamina (Q) o de lisina (K) ; X8 es un resto de metionina (M) , de norleucina (Nle) , de sulfóxido de metionina (m) , o de O-metil-L-homoserina (o) ; X9 es un resto de ácido gamma-glutámico (γGlu) ; X10 es un resto de ácido gamma-glutámico (γGlu) o está ausente; Z1 es un grupo protector presente opcionalmente que, si está presente, está unido al grupo amino de N-terminal, M es (i) un resto de cisteína unido covalentemente a un resto de colesterol mediante un enlazante hidrófilo, (ii) un resto de lisina unido covalentemente a un resto lipídico mediante un espaciador que comprende uno o más restos de ácido gamma-glutámico, o (iii) un resto lipídico, en el que M está unido covalentemente a un aminoácido C-terminal o interno de P mediante un espaciador que comprende uno o más restos de ácido gamma-glutámico; y Z2 es un grupo protector presente opcionalmente que, si está presente, está unido al grupo carboxilo C-terminal; y sales farmacéuticamente aceptable del mismo. en el que en análogo peptídico o sal del mismo tiene un pI de menos de 6, 0 y es un agonista dual del receptor de GLP-1 y del receptor de glucagón.

2. El análogo peptídico de la reivindicación 1, en el que M es (i) un resto de cisteína unido covalentemente a un resto de colesterol con un enlazador hidrófilo y el resto de cisteína está unido al C-terminal de P, (ii) un resto de lisina unido covalentemente a un resto lipídico mediante un espaciador que comprende uno o más restos de ácido gamma-glutámico y el resto de lisina está unido al C-terminal de P, o (iii) un resto de lisina unido covalentemente a un resto lipídico mediante un espaciador que comprende uno o más restos de ácido gamma-glutámico y el resto de lisina está unido a la posición X2 o X7 de P.

3. El análogo peptídico de la reivindicación 1, en el que el enlazante hidrófilo es un polímero etoxi que incluye de una a veinticuatro unidades etoxi o un polímero etoxi que incluye cuatro unidades etoxi.

4. El análogo peptídico de la reivindicación 1, en el que el resto lipídico es un resto de palmitoilo.

5. El análogo peptídico de la reivindicación 1, en el que el análogo peptídico es seleccionado del grupo que consiste en: OXM317 (SEC ID Nº : 60) ; OXM318 (SEC ID Nº : 61) ; OXM319 (SEC ID Nº : 62) ; OXM323 (SEC ID Nº : 64) ; OXM327 (SEC ID Nº : 66) ; y OXM329 (SEC ID Nº : 67) ;

o seleccionado del grupo que consiste en: OXM345 (SEC ID Nº : 69) ; OXM355 (SEC ID Nº : 70) ; OXM357 (SEC ID Nº : 71) ; OXM359 (SEC ID Nº : 72) ; OXM361 (SEC ID Nº : 73) ; OXM373 (SEC ID Nº : 74) ; OXM374 (SEC ID Nº : 75) ; OXM380 (SEC ID Nº : 76) ; OXM381 (SEC ID Nº : 77) ; OXM383 (SEC ID Nº : 78) ; OXM388 (SEC ID Nº : 79) ; OXM392 (SEC ID Nº : 80) ; OXM395 (SEC ID Nº : 81) ; OXM398 (SEC ID Nº : 82) ; OXM399 (SEC ID Nº : 83) ; OXM400 (SEC ID Nº : 84) ; OXM401 (SEC ID Nº : 85) ; OXM404 (SEC ID Nº : 86) ; OXM406 (SEC ID Nº : 87) ; OXM407 (SEC ID Nº : 88) ; OXM408 (SEC ID Nº : 89) ; OXM410 (SEC ID Nº : 91) ; OXM411 (SEC ID Nº : 92) ; OXM412 (SEC ID Nº : 93) ; OXM414 (SEC ID Nº : 95) ; OXM415 (SEC ID Nº : 96) ; OXM416 (SEC ID Nº : 97) ; OXM417 (SEC ID Nº : 98) ; OXM418 (SEC ID Nº : 99) ; OXM419 (SEC ID Nº : 100) ; OXM420 (SEC ID Nº : 101) ; y OXM421 (SEC ID Nº : 102) .

6. Un análogo peptídico que comprende la secuencia de aminoácidos HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEC ID Nº : 109) en la que

(A) el segundo aminoácido del N-terminal del péptido es sustituido por un aminoácido que vuelve al péptido resistente a la escisión e inactivación por dipeptidil peptidasa IV;

(B) el péptido incluye un resto lipídico o de colesterol unido covalentemente a un péptido mediante un espaciador que comprende un resto o más de ácido gamma-glutámico;

(C) el péptido incluye opcionalmente de una a tres sustituciones de aminoácidos además de la sustitución en la posición 2; y

(D) el péptido incluye opcionalmente un grupo protector que, si está presente, está unido al grupo carboxilo C-terminal del péptido;

en el que en análogo peptídico tiene un pI de menos de 6, 0 y es un agonista dual del receptor de GLP-1 y del receptor de glucagón, y sales farmacéuticamente aceptable del mismo.

7. El análogo peptídico de la reivindicación 6, en el que (i) el aminoácido sustituido por el segundo aminoácido del N-terminal es seleccionado del grupo que consiste en D-serina, ácido α-aminoisobutírico, y ácido 1-amino-1-ciclobutano carboxílico, (ii) el análogo peptídico incluye un resto de colesterol unido covalentemente al grupo tiol de un resto de cisteína que está unido covalentemente al grupo s-amino del resto de lisina en el C-terminal del análogo peptídico mediante un espaciador que comprende uno o más restos de ácido gamma-glutámico, (iii) en el que el análogo peptídico incluye un resto lipídico unido covalentemente al grupo s-amino de un resto de lisina, (iv) el análogo peptídico además incluye una o más sustituciones de aminoácidos en posiciones de aminoácidos seleccionadas del grupo que consiste en las posiciones 10, 12, 16, 17, 18, y 27, o (v) el análogo peptídico además incluye una o más sustituciones de aminoácidos seleccionadas del grupo que consiste en tirosina por lisina en la posición 10, lisina por serina en la posición 12, serina por ácido glutámico o ácido α-aminoisobutírico en la posición 16, arginina por ácido glutámico en la posición 17, arginina por alanina en la posición 18, glutamina por lisina en la posición 20, y metionina por norleucina u O-metil-L-homoserina en la posición 27.

8. El análogo peptídico de la reivindicación 7 (ii) , en el que el resto de colesterol está unido covalentemente al grupo tiol mediante un enlazante hidrófilo.

9. El análogo peptídico de la reivindicación 8, en el que (i) en enlazante hidrófilo es un polímero etoxi que incluye de una a doce unidades etoxi, o (ii) el enlazante hidrófilo es un polímero etoxi que incluye cuatro unidades etoxi.

10. El análogo peptídico de la reivindicación 7 (iii) , en el que el resto lipídico es un grupo de palmitoilo.

11. El análogo peptídico de la reivindicación 7 (iii) , en el que (i) el resto lipídico está unido covalentemente al grupo s-amino del resto de lisina mediante uno o más restos de ácido gamma-glutámico; (ii) el resto lipídico está unido covalentemente al grupo s-amino del resto de lisina en el C-terminal mediante uno o más restos de ácido gamma-glutámico; o (iii) el resto lipídico está unido covalentemente al grupo s-amino del resto de lisina mediante uno o más restos de ácido gamma-glutámico y el resto de lisina unido al resto de lisina en el C-terminal mediante uno o más restos de ácido gamma-glutámico.

12. El análogo peptídico de la reivindicación 7 (v) , en el que la tirosina en la posición 10 es reemplazado con una lisina y el resto lipídico se une covalentemente al grupo s-amino del resto de lisina mediante uno o más restos de ácido gamma-glutámico, opcionalmente, en el que el análogo peptídico incluye adicionalmente uno o más restos de ácido gamma-glutámico unidos covalentemente al C-terminal.

13. El análogo peptídico de la reivindicación 7 (v) , en el que la glutamina en la posición 20 es reemplazado con una lisina y el resto lipídico se une covalentemente al grupo s-amino de la lisina mediante uno o más restos de ácido gamma-glutámico.

14. El análogo peptídico de la reivindicación 13, en el que el análogo peptídico incluye adicionalmente uno o más restos de ácido gamma-glutámico unidos covalentemente al C-terminal.

15. El uso de uno o más de los análogos peptídicos de las reivindicaciones 1-14 en la fabricación de un medicamento para el tratamiento de un trastorno metabólico.