CIP 2015 : A61K 39/00 : Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

CIP2015AA61A61KA61K 39/00[m] › Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".
Notas[n] de A61K 39/00:
  • La preparación de composiciones que contienen antígenos o anticuerpos se clasifican igualmente en la subclase C12N, si la etapa del cultivo del microorganismo tiene interés.
  • Los grupos A61K 39/002 - A61K 39/12   cubren las preparaciones que contienen protozoos, bacterias, virus, o sus partes elementales, p. ej. partes de membranas.

A61K 39/002 · Antígenos de protozoos.

A61K 39/005 · · Antígenos de Tripanosoma.

A61K 39/008 · · Antígenos de Leishmania.

A61K 39/012 · · Antígenos de Coccidia.

A61K 39/015 · · Antígenos de Hemosporidia, p. ej. antígenos de Plasmodium.

A61K 39/018 · · · Antígenos de Babesia, p. ej. antígenos de Theileria.

A61K 39/02 · Antígenos bacterianos.

A61K 39/04 · · Mycobacterium, p. ej. Mycobacterium tuberculosis.

A61K 39/05 · · Corynebacterium; Propionibacterium.

A61K 39/07 · · Bacillus.

A61K 39/08 · · Clostridium, p. ej. Clostridium tetani.

A61K 39/085 · · Staphylococcus.

A61K 39/09 · · Streptococcus.

A61K 39/095 · · Neisseria.

A61K 39/10 · · Brucella; Bordetella, p. ej. Bordetella pertussis.

A61K 39/102 · · Pasteurella; Haemophilus.

A61K 39/104 · · Pseudomonas.

A61K 39/106 · · Vibrio; Campylobacter.

A61K 39/108 · · Escherichia; Klebsiella.

A61K 39/112 · · Salmonella; Shigella.

A61K 39/114 · · Fusobacterium.

A61K 39/116 · · Antígenos bacterianos polivalentes.

A61K 39/118 · Chlamydiaceae, p. ej. Chlamydia trachomatis o Chlamydia psittaci.

A61K 39/12 · Antígenos virales.

A61K 39/125 · · Picornaviridae, p. ej. Calicivirus.

A61K 39/13 · · · Virus de la poliomielitis.

A61K 39/135 · · · Virus de la fiebre aftosa.

A61K 39/145 · · Orthomyxoviridae, p. ej. virus de la influenza.

A61K 39/15 · · Reoviridae, p. ej. virus de la diarrea de la ternera.

A61K 39/155 · · Paramyxoviridae, p. ej. virus de la parainfluenza.

A61K 39/165 · · · Virus de la parotiditis o del sarampión.

A61K 39/17 · · · Virus de la enfermedad de Newcastle.

A61K 39/175 · · · Virus del moquillo canino.

A61K 39/187 · · Virus de la peste porcina.

A61K 39/193 · · Virus de encefalomielitis equina.

A61K 39/20 · · Virus de la rubeola.

A61K 39/205 · · Rhabdoviridae, p. ej. virus de la rabia.

A61K 39/21 · · Retroviridae, p. ej. virus de la anemia infecciosa equina.

A61K 39/215 · · Coronaviridae, p. ej. virus de la bronquitis infecciosa aviar.

A61K 39/225 · · · Virus de la gastroenteritis transmisible del cerdo.

A61K 39/23 · · Parvoviridae, p. ej. virus de la leucemia felina.

A61K 39/235 · · Adenoviridae.

A61K 39/245 · · Herpetoviridae, p. ej. virus del herpes simple.

A61K 39/25 · · · Herpesvirus varicellae.

A61K 39/255 · · · Virus de la enfermedad de Marek.

A61K 39/265 · · · Virus de la rinotraqueítis infecciosa.

A61K 39/27 · · · Virus de la rinoneumonía equina.

A61K 39/275 · · Poxviridae, p. ej. avipoxvirus.

A61K 39/285 · · · Virus de la viruela o virus de la varicela.

A61K 39/29 · · Virus de la hepatitis.

A61K 39/295 · · Antígenos virales polivalentes (virus de la viruela o de la varicela A61K 39/285 ); Mezclas de antígenos virales y bacterianos.

A61K 39/35 · Alergenos.

A61K 39/36 · · del polen.

A61K 39/38 · Antígenos de serpientes.

A61K 39/385 · Haptenos o antígenos, unidos a soportes.

A61K 39/39 · caracterizados por los aditivos inmunoestimulantes, p. ej. por los adyuvantes químicos.

A61K 39/395 · Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.

A61K 39/40 · · bacterianos.

A61K 39/42 · · virales.

A61K 39/44 · · Anticuerpos unidos a sus soportes.

CIP2015: Invenciones publicadas en esta sección.

Fragmentos Fab de anticuerpos modificados.

(19/11/2015) Un fragmento Fab de anticuerpo caracterizado por que la región constante de la cadena pesada termina en la cisteína intercatenaria de CH1.

Formulaciones terapéuticas estables.

(17/11/2015) Un método para fabricar y envasar un dispositivo de suministro transdérmico que comprende un anillo; en donde el método comprende las operaciones siguientes: (i) proporcionar un elemento de microproyección que tiene una pluralidad de microproyecciones ; (ii) proporcionar una formulación de revestimiento biocompatible que comprende un agente biológicamente activo que comprende hPTH y compuestos análogos al mismo; (iii) revestir el elemento de microproyección con la formulación de revestimiento biocompatible para formar dicho dispositivo de suministro transdérmico; y (iv) envasar dicho dispositivo de suministro transdérmico…

Uso de inhibidores de la vía del complemento para tratar enfermedades oculares.

(16/11/2015) Un inhibidor del complemento para uso en un método para el tratamiento de una enfermedad ocular asociada con la activación del complemento de un sujeto, en donde el inhibidor del complemento es un anticuerpo o un fragmento de unión a antígeno del mismo o un ácido nucleico que codifica el anticuerpo o fragmento de unión a antígeno, en donde el anticuerpo o fragmento de unión a antígeno del mismo se une específicamente a Factor D.

Proteína E1E2 del VHC adyuvantada con MF59 más vector de alfavirus que codifica E1E2 del VHC para provocar linfocitos T específicos del VHC.

(16/11/2015) Una primera composición que comprende un complejo de proteína E1E2 del virus de la hepatitis C (VHC) y un adyuvante MF59, para su uso en un procedimiento de estimulación de una respuesta inmunitaria en un sujeto vertebrado, comprendiendo dicho procedimiento: administrar al menos una vez la primera composición a dicho sujeto vertebrado; y posteriormente administrar al menos una vez una segunda composición que comprende un vector de alfavirus que comprende un ácido nucleico que codifica un complejo de E1E2 del VHC a dicho sujeto vertebrado, por la cual el ácido nucleico que codifica un complejo de E1E2 del VHC se expresa en una o más células del sujeto y se produce el complejo de proteína E1E2.

Mimotopos de alfa-sinucleína y vacunas de los mismos para el tratamiento de los trastornos neurodegenerativos.

(12/11/2015) Por lo menos un compuesto que comprende un péptido que presenta la secuencia de aminoácidos seleccionada de entre el grupo que consiste en CDQPVLPD, CDMPVLPD, CDSPVLPD, CDQPVLPDN, CDMPVLPDN, CDSPVLPDN, CHDRPVTPD, CDRPVTPD, CDVPVLPD, CDTPVYPD, CDTPVIPD, CHDRPVTPDN, CDRPVTPDN, CDVPVLPDN, CDTPVYPDN, CDQPVLPDG, CDMPVLPDG, CDSPVLPDG, CDHPVHPDS, CDMPVSPDR, CDRPVYPDI, CDHPVTPDR, CDTPVLPDS, CDMPVTPDT, CDAPVTPDT, CDSPVVPDN, CDLPVTPDR, CDSPVHPDT, CDAPVRPDS, CDMPVWPDG, CDRPVQPDR, CYDRPVQPDR, CDMPVDADN, DQPVLPDC y DMPVLPDC, para la utilización para la prevención y/o el tratamiento de las sinucleinopatías.

Vacuna monodosis con Mycoplasma hyopneumoniae.

(10/11/2015) Una vacuna que contiene una bacterina de Mycoplasma hyopneumoniae para su uso en el tratamiento o prevención de una enfermedad o trastorno en cerdos causado por una infección por Mycoplasma hyopneumoniae; en la que dicha vacuna es administrada en una única dosis a dichos cerdos a los 3 días de edad; y en la que dicha única dosis es eficaz en el tratamiento o en la prevención de los síntomas causados por una infección por Mycoplasma hyopneumoniae.

MÉTODO PARA DIAGNOSTICAR Y MONITORIZAR LA PRESENCIA DE CÁNCER EN UN SUJETO HUMANO.

(05/11/2015). Solicitante/s: SERVICIO ANDALUZ DE SALUD. Inventor/es: SALINAS MARTÍN,MANUEL VICENTE.

Método para diagnosticar y monitorizar la presencia de cáncer en un sujeto humano. Método de obtención de datos útiles para diagnosticar la presencia de un cáncer en un individuoy para determinar el estadío o grado de progresión de ese cáncer. También permite determinar la respuesta al tratamiento y agrupar a los sujetos en respondedores y no respondedores. Kit o dispositivo que comprende los elementos necesarios para llevar a cabo dicho método y sus usos.

Moléculas de unión a antígeno con afinidad de unión a receptores Fc y función efectora incrementadas.

(30/09/2015) Anticuerpo anti-CD20 de tipo II humanizado que comprende: (a) una región variable de cadena pesada seleccionada de entre el grupo que consiste de SEC ID nº 32 y SEC ID nº 40, y (b) la región variable de cadena ligera de KV1 de SEC ID nº 76.

Reactivos y métodos para el tratamiento y la prevención del cáncer.

(16/09/2015) Un método para preparar un agente anticanceroso que comprende (a) exponer ex vivo una porción de células obtenidas a partir de una línea celular de cáncer o una porción de células tumorales obtenidas de un paciente a un agente seleccionado entre tapsigargina y tapsigargicina, con el fin de crear células tumorales tratadas; (b) lisar dichas células tumorales tratadas para crear fragmentos de células, en donde dichos fragmentos son adecuados para generar un efecto terapéutico contra el cáncer.

Vacunas recombinantes contra copépodos caligidos (piojos de mar) y secuencias de antígeno de las mismas.

(02/09/2015) Una vacuna recombinante contra una infección por copépodos caligidos en peces, comprendiendo la vacuna una cantidad inmunológicamente eficaz de un antígeno proteico purificado recombinante similar a la vitelogenina y un adyuvante, un diluyente o un vehículo farmacéuticamente aceptable, en donde el antígeno es un antígeno peptídico recombinante que comprende una secuencia de aminoácidos tal y como se describe en SEQ ID NO: 2 o 20.

Nuevas composiciones inmunogénicas para la prevención y tratamiento de enfermedad meningocócica.

(26/08/2015) Una composición que comprende al menos una proteína recombinante que comprende una secuencia de aminoácidos que tiene identidad de secuencia mayor del 90 % con la secuencia de aminoácidos de una cualquiera de SEC ID Nº: 250, 248 y 252, a condición de que dicha proteína no sea SEC ID Nº: 10 o 13 del documento WO03/020756.

Nuevas composiciones inmunogénicas para la prevención y tratamiento de enfermedad meningocócica.

(26/08/2015) Una composición que comprende al menos una proteína que comprende una secuencia de aminoácidos que tiene identidad de secuencia mayor del 97 % con la secuencia de aminoácidos de una cualquiera de SEC ID Nº: 58, 56 y 60.

Supresión de una respuesta inmunitaria de hipersensibilidad con un antígeno no relacionado derivado de material fuente de alérgenos.

(26/08/2015) Un antígeno para su uso en el tratamiento de una respuesta inmunitaria de hipersensibilidad de tipo 1 en un individuo que lo necesita, en el que i) la respuesta inmunitaria de hipersensibilidad de tipo 1 la desencadena un alérgeno tras la exposición del individuo a un material fuente ambiental o dietético, comprendiendo dicho alérgeno; ii) el antígeno proteico es obtenible de dicho material fuente ambiental o dietético; iii) el antígeno proteico no está relacionado con un alérgeno, o alérgenos, desencadenante de la respuesta inmunitaria de hipersensibilidad en el sentido en el que 1) no se une a anticuerpos…

Un complejo de anticuerpo biespecífico y digoxigenina conjugada a un agente terapéutico o de diagnóstico.

(19/08/2015) Un complejo de a) un anticuerpo biespecífico específico contra digoxigenina y una proteína diana, que comprende un primer sitio de unión al antígeno que se une a digoxigenina y un segundo sitio de unión al antígeno que se une a una proteína diana, y b) digoxigenina, en el que la digoxigenina está conjugada a un agente terapéutico o de diagnóstico seleccionado del grupo que consiste en un péptido, un compuesto pequeño, un compuesto pequeño radiactivamente marcado y un reactivo de obtención de imágenes, en el que dicho sitio de unión al antígeno que se une específicamente a digoxigenina comprende como dominio variable de la cadena…

Prevención y tratamiento de una enfermedad sinucleinopática.

(19/08/2015) Una composición farmacéutica que comprende un agente que induce una respuesta inmunógena contra alfa-sinucleína, para el uso en la profilaxis o el tratamiento de una enfermedad caracterizada por los cuerpos de Lewy o la agregación de alfa-sinucleína en el cerebro, en la que el agente es alfa-sinucleína o un fragmento inmunógeno de la misma o un anticuerpo hacia alfa-sinucleína o un fragmento inmunógeno de la misma, y en la que la enfermedad es la enfermedad de Parkinson, demencia con cuerpos de Lewy, enfermedad con cuerpos de Lewy difusos, disautonomía pura, disfagia con cuerpos de Lewy, enfermedad con cuerpos de Lewy incidentales, enfermedad con cuerpos de…

Propiedades de coadyuvancia y potenciación inmunitaria de productos naturales de Onchocerca volvulus.

(12/08/2015) Una composición inmunogénica para potenciar una respuesta inmunitaria específica a un radical antigénico en un mamífero que necesita de tal respuesta inmunitaria, comprendiendo la composición: un radical antigénico, en donde el radical antigénico es un poliaminoácido, y en donde el radical antigénico no es una proteína secretada asociada a la activación de Onchocerca volvulus (Ov-ASP); y un coadyuvante que comprende una cantidad eficaz de Ov-ASP.

Vacunación con vectores poxvirales mediante alteración mecánica epidérmica.

(05/08/2015) Un poxvirus vivo, modificado, no replicante, que comprende un ácido nucleico que codifica un antígeno peptídico o polipeptídico que es exógeno al poxvirus, en el que el poxvirus infecta células humanas, pero no se replica en ellas; para su uso en un procedimiento para suscitar una respuesta inmunitaria de linfocitos T de memoria en el antígeno exógeno, administrando el poxvirus a una epidermis mecánicamente alterada de un sujeto, de tal manera que el poxvirus que expresa el antígeno exógeno infecta la epidermis alterada y suscita una respuesta inmunitaria de linfocitos T de memoria.

Terapias para el cáncer y composiciones farmacéuticas usadas en las mismas.

(05/08/2015) Una composición farmacéutica que comprende: un oligonucleótido y un agente quimioterapéutico, en la que el oligonucleótido comprende la SEC ID Nº 1251, o el complemento de la misma.

Composiciones y métodos para diagnosticar y tratar el cáncer.

(05/08/2015) Una composición farmacéutica que comprende un receptor FZD8 soluble y un vehículo, excipiente y/o estabilizante farmacéuticamente aceptable, en donde la secuencia de aminoácidos del receptor FZD8 soluble consiste en los restos 28 a 158 de la SEC ID Nº 7, unida a una secuencia de no receptor FZD, en donde la secuencia de no receptor FZD comprende un Fc humano.

Compuestos oligonucleótidos inmuno reguladores (IRO) para modular la respuesta inmune basada en receptor semejante a Toll.

(05/08/2015) Un antagonista de TLR que comprende un compuesto oligonucleótido inmuno regulador (IRO) que es un antagonista para uno o más TLR que tiene la estructura en la que: CG es un resto de oligonucleótido que es CpG, C*pG, C*pG* o CpG*, en el que C es citosina, C* es un derivado de nucleótido de pirimidina que es un nucleótido de pirimidina que tiene una base que no es citosina, timina o uracilo y/o un azúcar que no es ribosa ó 2'-desoxiribosa y puede estar presente en el núcleo de un oligonucleótido, G es guanosina, y G* es un derivado de nucleótido de purina que es un nucleótido de purina que tiene una base que no es guanina o adenina y/o un azúcar que no es ribosa ó 2'-desoxiribosa y puede estar presente en el núcleo de un oligonucleótido; N1-N3, en cada aparición, es independientemente i) un nucleótido, ii) un derivado de nucleótido…

Anticuerpos monoclonales humanos para ligandos 1 (PD-L1) de muerte programada.

(29/07/2015) Un anticuerpo monoclonal humano aislado o una porción de enlace a antígeno del mismo que se enlazan específicamente a PD-L1, que comprende: (a) una región variable de cadena pesada CDR1 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 22; (b) una región variable de cadena pesada CDR2 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 32; (c) una región variable de cadena pesada CDR3 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 42; (d) una región variable de cadena ligera CDR1 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº 52; (e) una región variable de cadena ligera CDR2 que comprende aminoácidos que tienen la secuencia definida en la SEC ID nº…

Anticuerpos monoclonales contra la proteína RGM A y usos de los mismos.

(29/07/2015) Un anticuerpo monoclonal que comprende un dominio de unión a antígeno, siendo dicho anticuerpo capaz de unirse con un epítopo de una molécula de RGM, comprendiendo dicho dominio de antígeno un dominio variable de cadena pesada que tiene al menos tres regiones determinantes de complementariedad y un dominio variable de cadena ligera que tiene al menos tres regiones determinantes de complementariedad, donde las regiones determinantes de complementariedad del dominio variable de cadena pesada tienen la secuencia de aminoácidos de SEC ID Nº: 57, SEC ID Nº: 58 y SEC ID Nº: 59 y donde las regiones determinantes de complementariedad…

Anticuerpos que reconocen fosfo-Tau.

(22/07/2015) Un anticuerpo o parte funcional de éste que se une específicamente a un fosfo-epítopo en una proteína Tau de mamíferos, en el que dicho anticuerpo o parte funcional de éste tiene una alta afinidad de unión para proteína Tau soluble e insoluble, y modula los niveles de Tau soluble e insoluble, en el que el fosfo-epítopo es los aminoácidos 405-411 ó 405-412 que tienen una Ser fosforilada en la posición 409 (pS409), y en el que el anticuerpo o parte funcional de éste se une a la proteína Tau de mamíferos con una constante de disociación de menos de 10 nM según se mide por resonancia de plasmón superficial, en el que el anticuerpo o parte funcional de éste no se une al epítopo no fosforilado correspondiente.

Fragmentos de PTEC.

(22/07/2015) Péptido que consiste en 6 a 20 residuos aminoácidos y que deriva de la secuencia de aminoácidos VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEC ID nº 23), en el que dicho péptido comprende la secuencia de aminoácidos WWLGID (SEC ID nº 24).

Anticuerpo antiglucoesfingolípido de tipo I extendido, derivados del mismo y utilización.

(22/07/2015). Solicitante/s: Glyconex Inc. Inventor/es: HAKOMORI, SEN-ITIROH, HANDA, KAZUKO, CHANG,TONG-HSUAN, TING,JERRY, HONG,TSAI-HSIA, YANG,MEI-CHUN, LIU,LIAHNG-YIRN, CHANG,SHU-YEN, CHEN,YING-JIN, WEN,JAW-YUAN.

Anticuerpo monoclonal humano o parte de unión a antígeno del mismo que se une específicamente a un epítopo que comprende un glucoesfingolípido de cadena de tipo I extendido que comprende Leb, en el que dicho epítopo es expresado en una célula cancerosa, en el que dicho anticuerpo o parte de unión a antígeno del mismo no se une a eritrocitos humanos, y en el que el anticuerpo presenta una región variable de cadena pesada que presenta la secuencia de aminoácidos SEC ID nº 15, y una región variable de cadena ligera que presenta la secuencia de aminoácidos SEC ID nº 17.

PDF original: ES-2549877_T3.pdf

Compuestos oligonucleótidos inmuno reguladores (IRO) para modular la respuesta inmune basada en receptor semejante a Toll.

(15/07/2015) Un compuesto antagonista de TLR que tiene la estructura**Fórmula** en la que: CG es un resto de oligonucleótido y C es citosina o un derivado de nucleótido de pirimidina, en el que el derivado de nucleótido de pirimidina se selecciona del grupo que consiste en 5-hidroxicitosina, 5-hidroximetilcitosina, N4- alquilcitosina, N4-etilcitosina, araC, 5-OH-dC, N3-Me-dC, y 4-tiouracilo; G es guanosina o un derivado de nucleótido de purina, en el que el derivado de nucleótido de purina se selecciona del grupo que consiste en 7-deaza-G, 7- deaza-dG, ara-G, 6-tio-G, Inosina, Iso-G, loxoribina, TOG(7-tio-8-oxo)-G, 8-bromo-G, 8-hidroxi-G, 5-aminoformicina B, Oxoformicina, 7-metil-G, 9-p-clorofenil-8-aza-G, 9-fenil-G,…

Péptidos y su aplicación en terapéutica.

(15/07/2015) Vacuna que contiene un compuesto inmunógeno que comprende un péptido que tiene un tamaño comprendido entre 10 y 30 aminoácidos, y que tiene más de 80% de identidad con una de las secuencias peptídicas de citoquinas siguientes: 39-VEIIATMKKKGEKRCLNPESKA-60 (SEQ ID Nº 18), 51-ADPSEEWVQKYVSDLELSA-69 (SEQ ID Nº 27), 52-ADPSESWVQEYVYDLELN-69 (SEQ ID Nº 28), 51-ANPEKKWVREYINSLEMS-68 (SEQ ID Nº 34), 114-RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLL-149 (SEQ ID Nº 26), 80-ISRIAVSYQTKVNLLS-95 (SEQ ID Nº 6), 124-FQLEKGDRLSAEINR-138 (SEQ ID Nº 7), 1-MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKN-36 (SEQ ID Nº 8), 118-MAELSPAAKTGKRKRS-133 (SEQ ID Nº 9), 20-PNMLRDLRDAFSRVKTFFQMKDQLDNLLLKE-50 (SEQ ID Nº 10), 5-ITLQEIIKTLNSL-17 (SEQ…

Métodos para tratar estados asociados con la acumulación excesiva de matriz celular.

(15/07/2015) Combinación de agentes que inhibe el TGF•para su uso en el tratamiento de un estado fibrótico asociado con una acumulación excesiva de matriz extracelular en tejidos u órganos, estando prevista la combinación de agentes para reducir la acumulación excesiva de matriz extracelular asociada con la sobreproducción y/o la actividad del TGF• en un tejido y/u órgano, o en un lugar de lesión cutánea, utilizándose la combinación de agentes que inhiben el TGF• en una cantidad suficiente para inhibir la sobreproducción y/o la actividad del TGF•, resultando el uso de dicha combinación de agentes en una mayor reducción de la acumulación de matriz extracelular que cuando cada agente se utiliza por separado, reduciéndose la acumulación de matriz extracelular en un…

Antígenos DIVA (de Diferenciación entre Animales Vacunados e Infectados) de Erlichia canis.

(15/07/2015). Solicitante/s: IDEXX LABORATORIES, INC.. Inventor/es: BEALL,MELISSA, KRAH,EUGENE REGIS III.

Un método para distinguir entre un animal que ha sido infectado con Ehrlichia canis y un animal que no ha sido infectado con E. canis, comprendiendo el método: (a) poner en contacto una muestra biológica de un animal con uno o más polipéptidos purificados que comprenden la secuencia de aminoácidos expuesta en el SEQ ID NO: 10; y (b) detectar si los anticuerpos de la muestra se unen específicamente a los uno o más polipéptidos purificados; en donde si los anticuerpos de la muestra se unen específicamente a los uno o más polipéptidos purificados, en ese caso el animal ha sido infectado con E. canis.

PDF original: ES-2550140_T3.pdf

Vacuna contra Streptococcus pneumoniae.

(15/07/2015) Una composición inmunógena que comprende al menos 2 proteínas de S. pneumoniae en la que una de las proteínas es PhtD y la otra proteína es neumolisina destoxificada (Ply).

Péptidos de unión al receptor del factor 1 de crecimiento similar a la insulina.

(15/07/2015). Solicitante/s: Janssen Biotech, Inc. Inventor/es: DIEM,MICHAEL, O\'NEIL,KAREN.

Un polipéptido aislado que comprende un polipéptido que tiene la secuencia mostrada en SEC ID Nº: 1-13, en el que dicho polipéptido puede: (a) unirse a IGF1R; y (b) transcitosarse a través de células endoteliales.

PDF original: ES-2550040_T3.pdf

Moléculas de unión a ILT3 y usos de las mismas.

(15/07/2015) Un anticuerpo aislado, o un fragmento de unión a antígeno del mismo, que comprende: una región determinante de complementariedad 1 (CDR1 de VH) de la región variable de cadena pesada (VH) que comprende la secuencia de aminoácidos mostrada en la SEC ID Nº 3; una región determinante de complementariedad 2 (CDR2 de VH) de la región variable de cadena pesada (VH) que comprende la secuencia de aminoácidos mostrada en la SEC ID Nº 4; una región determinante de complementariedad 3 (CDR3 de VH) de la región variable de cadena pesada (VH) que comprende la secuencia de aminoácidos mostrada en la SEC ID Nº 5; una región determinante de complementariedad 1 (CDR1 de VL) de la región variable de cadena ligera (VL) que comprende la secuencia de aminoácidos mostrada en la SEC ID Nº 6; una región determinante…

‹‹ · 11 · 16 · 19 · 20 · · 22 · · 24 · 27 · 33 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015