CIP 2015 : C07K 16/18 : contra materiales animales o humanos.

CIP2015CC07C07KC07K 16/00C07K 16/18[1] › contra materiales animales o humanos.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C07 QUIMICA ORGANICA.

C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales.

C07K 16/18 · contra materiales animales o humanos.

CIP2015: Invenciones publicadas en esta sección.

Productos génicos de expresión diferencial en tumores y su uso.

(31/10/2018) Composición farmacéutica para su uso en un método para el tratamiento de una enfermedad de cáncer que se distingue por la expresión de un antígeno asociado a un tumor, que comprende uno o varios componentes seleccionados del grupo formado por: (i) un antígeno asociado a un tumor o una parte del mismo, (ii) un ácido nucleico que codifica un antígeno asociado a un tumor o una parte del mismo, (iii) un anticuerpo que se une a un antígeno asociado a un tumor, (iv) un ácido nucleico no codificante que hibrida de forma específica con un ácido nucleico que codifica un antígeno asociado a un tumor y (v) una célula huésped que…

Proteínas de unión a calicreína plasmática.

(30/10/2018) Un anticuerpo que se une a la forma activa de calicreína plasmática humana y no se une a precalicreína humana, y en el que el anticuerpo se selecciona del grupo que consiste en (i) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVS S y secuencia VL de DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (ii) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGS LRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGI TVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRTGIPRRDAFDIWG QGTMVTVSSASTKGPSVFPLAPSSKS y una secuencia VL de QDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPNLLIYKASTLESG VPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (iii) un anticuerpo que comprende una secuencia…

Receptor de antígeno universal que expresa células inmunes para direccionamiento de antígenos múltiples diversos, procedimiento para fabricación del mismo y utilización del mismo para tratamiento de cáncer, infecciones y enfermedades autoinmunes.

(30/10/2018). Ver ilustración. Solicitante/s: GEMoaB Monoclonals GmbH. Inventor/es: BACHMANN,MICHAEL, EHNINGER,ARMIN.

Ácido nucleico que codifica un receptor quimérico universal, en el que el receptor comprende tres dominio, donde - el primer dominio es una dominio de unión a marcador, - el segundo dominio es una bisagra extracelular y un dominio de transmembrana y - el tercer dominio es un dominio de transducción de señal en el que el dominio de unión a marcador está unido a un marcador derivado de una proteína nuclear humana en el que el marcador es un epítopo lineal corto E5B9 de la proteína nuclear humana La y en el que el dominio de unión a marcador es un anticuerpo o un fragmento de unión a antígeno del mismo y donde el dominio de unión a marcador está unido al epítopo La 5B9 respectivo.

PDF original: ES-2688035_T3.pdf

Anticuerpos específicos para polipéptido amiloide de islote humano (HIAPP) y usos de los mismos.

(25/10/2018) Anticuerpo contra polipéptido amiloide de islote (IAPP) monoclonal humano o un fragmento de unión a IAPP y/o proIAPP del mismo, caracterizado por que el anticuerpo reconoce preferiblemente agregados de IAPP y/o proIAPP humanos que comprenden oligómeros y/o fibrillas de IAPP y/o proIAPP sobre IAPP y/o proIAPP fisiológicos, y no reconoce sustancialmente péptido b-amiloide patológico (Ab1-42) en cerebro humano de la enfermedad de Alzheimer, en el que el anticuerpo se selecciona del grupo que consiste en: (a) un anticuerpo que se une específicamente a un epítopo de IAPP que comprende la secuencia de aminoácidos…

Endodermo de intestino proximal dorsal y ventral que expresa PDX-1.

(24/10/2018). Solicitante/s: VIACYTE, INC. Inventor/es: BAETGE,EMMANUEL E, D'AMOUR,KEVIN ALLEN, AGULNICK,ALAN D, ELIAZER,SUSAN.

Cultivo celular in vitro que comprende células humanas, en el que al menos el 10% de dichas células humanas son células de endodermo que expresan un marcador seleccionado del grupo que consiste en ONECUT2, SOX9 y PROX1 y que expresan la proteína factor 1 de homeocaja pancreático-duodenal (PDX1).

PDF original: ES-2687233_T3.pdf

Fijación como objetivo de ABCB5 para la terapia del cáncer.

(24/10/2018). Solicitante/s: THE BRIGHAM AND WOMEN'S HOSPITAL, INC.. Inventor/es: FRANK,MARKUS,H, SAYEGH,MOHAMED,H, FRANK,NATASHA Y.

Un anticuerpo monoclonal aislado que se une selectivamente a ABCB5, que comprende un dominio variable de la cadena pesada de inmunoglobulina que tiene una CDR1-H1, que comprende la secuencia de aminoácidos DYYMY, una CDR2-H2, que comprende la secuencia de aminoácidos TINDGGTHTY y una CDR3-H3, que comprende la secuencia de aminoácidos DDYYYGSHFDAMDY, y un dominio variable de la cadena ligera de inmunoglobulina que tiene una CDR1-L1, que comprende la secuencia de aminoácidos RASKSVSTSGYMH, una CDR2-L2, que comprende la secuencia de aminoácidos LVSNLES y una CDR3-L3, que comprende la secuencia de aminoácidos QHIRELTR.

PDF original: ES-2687270_T3.pdf

Anticuerpos anti-tau humanos.

(18/10/2018). Solicitante/s: Biogen International Neuroscience GmbH. Inventor/es: NITSCH, ROGER, CHEN,FENG, HOCK,CHRISTOPH, GRIMM,JAN, BAERISWYL,JEAN-LUC.

Un anticuerpo anti-tau monoclonal humano aislado, o un fragmento de unión a tau del mismo que se une específicamente a un epítopo tau que comprende la secuencia de aminoácidos de SEQ ID NO: 7 e (i) es capaz de unirse a tau patológicamente modificado; (ii) se une a tau agregada patológicamente en la fase pre-ovillos, en ovillos neurofibrilares (NFT), hilos del neurópilo y/o neuritas distróficas en el cerebro; y (iii) no se une sustancialmente a formas fisiológicas de tau en el cerebro de un donante sano cuando se evalúa mediante tinción inmunohistoquímica.

PDF original: ES-2686550_T3.pdf

Productos génicos de expresión diferencial en tumores y su uso.

(05/10/2018). Solicitante/s: Ganymed Pharmaceuticals GmbH. Inventor/es: TURECI, OZLEM, SAHIN, UGUR, KOSLOWSKI,MICHAEL.

Anticuerpo que se une de forma selectiva a una proteína o un polipéptido, en donde la proteína o el polipéptido son codificados por un ácido nucleico que comprende una secuencia de ácido nucleico seleccionada del grupo formado por SEQ ID NO: 20, 21, 54, 55, 56 y 57.

PDF original: ES-2685053_T3.pdf

Marcadores bioquímicos para la evaluación del riesgo de CVD.

(05/10/2018) Un método de bioensayo para la cuantificación de fragmentos peptídicos que comprende un neoepítopo en el extremo C-terminal o N-terminal formado por escisión in vivo de mimecano por una proteinasa, dicho método comprende poner en contacto una muestra derivada de un paciente que comprende dichos fragmentos peptídicos con un ligando inmunológico que tiene afinidad de unión específica por dicho neoepítopo y determinar el nivel de unión de dicho ligando inmunológico a fragmentos de péptidos en dicha muestra, en donde dicho ligando inmunológico es reactivo con péptidos que terminan en la secuencia de neoepítopo pero no es reactiva sustancialmente con mimecano intacto y no es reactiva específicamente con péptidos en los que la secuencia terminal de neoepítopo se extiende por uno o más aminoácidos adicionales, dicho método comprende, además, la comparación…

Proteínas que se unen a beta amiloide.

(03/10/2018). Solicitante/s: AbbVie Inc. Inventor/es: HILLEN, HEINZ, EBERT, ULRICH, STRIEBINGER,ANDREAS, BARGHORN,STEFAN, BENATUIL,LORENZO, GIAISI,SIMONE.

Un anticuerpo que se une a globulómero beta amiloide que comprende: una región variable de cadena pesada que tiene la secuencia de aminoácidos que se expone en SEQ ID NO: 6 o SEQ ID NO: 10; y una región variable de cadena ligera que tiene la secuencia de aminoácidos que se expone en SEQ ID NO: 14.

PDF original: ES-2684475_T3.pdf

Anticuerpo que se dirige a la proteína Siglec-15 relacionada con osteoclastos.

(30/05/2018) Un ADNc que comprende una secuencia de polinucleótidos que codifica una cadena pesada y una cadena ligera de un anticuerpo o un fragmento funcional del mismo que reconoce específicamente uno o más polipéptidos, que comprende una secuencia de aminoácidos descrita en uno cualquiera de los siguientes puntos (a) a (i) e inhibe la formación de osteoclastos y/o la resorción ósea osteoclástica: (a) una secuencia de aminoácidos representada por SEQ ID NO: 2 en el Listado de secuencias; (b) una secuencia de aminoácidos que consiste en los restos de aminoácidos 21 a 328 de la secuencia de aminoácidos representada por…

Anticuerpos de quimiocinas PAN-ELR+CXC.

(16/05/2018). Solicitante/s: ELI LILLY AND COMPANY. Inventor/es: WITCHER,DERRICK,RYAN, BEIDLER,CATHERINE,BRAUTIGAM, KIKLY,KRISTINE,KAY, STRIFLER,BETH ANN, BOYLES,JEFFREY STREETMAN.

Un anticuerpo que se une a Gro-alfa, Gro-beta, Gro-gamma, ENA-78, GCP-2, NAP-2 e IL-8 humanas, comprendiendo el anticuerpo una cadena ligera y una cadena pesada, en el que la cadena ligera comprende una región variable de cadena ligera (LCVR) y la cadena pesada comprende una región variable de cadena pesada (HCVR), en el que la LCVR comprende LCDR1, LCDR2, LCDR3 y la HCVR comprende HCDR1, HCDR2, HCDR3, en el que LCDR1 es RASQSISNNLH (SEQ ID NO: 7), LCDR2 es YTSRSVS (SEQ ID NO: 8), LCDR3 es GQNNEWPEV (SEQ ID NO: 9), HCDR1 es GYEFTSYWIH (SEQ ID NO: 10), HCDR2 es NISPNSGSANYNEKFKS (SEQ ID NO: 11) y HCDR3 es EGPYSYYPSRXaaYYGSDL (SEQ ID NO: 20) en el que Xaa es E o Q.

PDF original: ES-2675404_T3.pdf

Diseño de armazón de heteromultímero multivalente y constructos.

(09/05/2018). Solicitante/s: Zymeworks Inc. Inventor/es: DIXIT,SURJIT BHIMARAO, D'ANGELO,IGOR EDMONDO PAOLO, POON,DAVID KAI YUEN.

Un heteromultímero que comprende: al menos una primera proteína monomérica que comprende (i) un primer polipéptido transportador que comprende un primer segmento de albúmina sérica y (ii) al menos un polipéptido de carga y al menos una segunda proteína monomérica que comprende (iii) un segundo polipéptido transportador que comprende un segundo segmento de albúmina sérica y (iv) al menos un polipéptido de carga; donde dicho primer polipéptido transportador es distinto del segundo polipéptido transportador mencionado, y donde dichos polipéptidos transportadores se autoensamblan para formar una estructura cuasinatural de albúmina sérica.

PDF original: ES-2676878_T3.pdf

Anticuerpos monoclonales de unión a mcm5.

(09/05/2018). Solicitante/s: Arquer Diagnostics Limited. Inventor/es: LASKEY, RONALD, ALFRED, STOEBER,KAI.

Un anticuerpo monoclonal que se une específicamente a Mcm5, que se une a un epítopo que tiene una secuencia de aminoácidos de (i) la SEQ ID NO: 2; o (ii) la SEQ ID NO: 1.

PDF original: ES-2678049_T3.pdf

Productos génicos de expresión diferencial en tumores y su uso.

(25/04/2018) Composición farmacéutica para su uso en un método para tratar una enfermedad de cáncer o para vacunar contra la misma, que comprende uno o varios componentes seleccionados del grupo formado por: (i) un antígeno asociado a un tumor codificado por una secuencia de ácido nucleico según SEQ ID NO: 7 u 8, o una parte del mismo que comprende al menos 6 aminoácidos contiguos del antígeno asociado al tumor, (ii) un ácido nucleico que codifica un antígeno asociado a un tumor o una parte del mismo que comprende al menos 6 aminoácidos contiguos del antígeno asociado a un tumor, en donde el antígeno asociado a un tumor es codificado por la secuencia de ácido nucleico según SEQ ID NO: 7 u 8, (iii) un anticuerpo que se une a un antígeno asociado a un tumor, el cual es…

Anticuerpos humanizados que reconocen la alfa-sinucleína.

(18/04/2018). Solicitante/s: Prothena Biosciences Limited. Inventor/es: SALDANHA, JOSE, NIJJAR,TARLOCHAN S.

Un anticuerpo que se une a alfa sinucleína, que comprende una región variable de cadena pesada madura que tiene la secuencia de aminoácidos de la SEQ ID NO:10, una región variable de cadena ligera madura que tiene la secuencia de aminoácidos de la SEQ ID NO:5, una región constante de cadena pesada que tiene la secuencia de aminoácidos de la SEQ ID No: 32 con o sin la lisina de C-terminal, y la región constante de cadena ligera que tiene la secuencia de aminoácidos designada SEQ ID No: 13.

PDF original: ES-2669395_T3.pdf

Ensayo para entactógenos.

(18/04/2018) Un compuesto de la fórmula: **(Ver fórmula)** en la que: R1 es H, alquilo inferior o un grupo protector, en el que el término alquilo inferior representa un radical hidrocarburo monovalente saturado ramificado o no ramificado que contiene de 1 a 10 átomos de carbono, y en el que el grupo protector es t-butoxicarbonilo (t-Boc), fluorenilmetiloxicarbonilo (Fmoc), acetaminometilo (Acm), trifenil metilo (Trt), benciloxicarbonilo, bifenilisopropiloxicarbonilo, 1-amiloxicarbonilo, isoborniloxicarbonilo, alfa-dimetil-3,5- dimetoxibenciloxicarbonilo, o-nitrofenil-sulfenilo, 2-ciano-1,1-dimetil-etoxicarbonilo bromobenciloxi, carbamoilo o formilo R2 es -(CH2)nC(O)R6 o -(CH2)nR6, R3 y R4 son independientemente H o alquilo inferior o un grupo protector, en el que el término alquilo inferior representa…

Composición y método para el diagnóstico y el tratamiento de enfermedades asociadas con la degeneración de las neuritas.

(18/04/2018). Solicitante/s: AbbVie Deutschland GmbH & Co KG. Inventor/es: MUELLER,BERNHARD, HUANG,LILI, BARDWELL,PHILIP D, KUTSKOVA,YULIYA, MEMMOTT,JOHN.

Un anticuerpo monoclonal anti-Molécula de Orientación Repulsiva a (RGMa) aislado que comprende una región variable de cadena pesada que comprende una región determinante de la complementariedad (CDR) que compren- de la secuencia de aminoácidos de SEQ ID NO: 2, una CDR2 que comprende la secuencia de aminoácidos de SEQ ID NO: 3 y una CDR3 que comprende la secuencia de aminoácidos de SEQ ID NO: 4 y una región variable de cadena ligera que comprende una CDR1 que comprende la secuencia de aminoácidos de SEQ ID NO: 6, una CDR2 que comprende la secuencia de aminoácidos de SEQ ID NO: 7 y una CDR3 que comprende la secuencia de aminoácidos de SEQ ID NO: 8 o SEQ ID NO: 73.

PDF original: ES-2676725_T3.pdf

Humanización de anticuerpos de conejo utilizando un marco universal de anticuerpos.

(11/04/2018). Solicitante/s: ESBATech, an Alcon Biomedical Research Unit LLC. Inventor/es: URECH,DAVID, BORRAS,LEONARDO.

Un marco aceptor para injertar CDR de lagomorfo que comprende un marco de cadena pesada variable humana que tiene al menos un 95% de identidad con la SEQ ID NO. 4 y que comprende treonina (T) en la posición 24, alanina (A) o glicina (G) en la posición 56, treonina (T) en la posición 84, valina (V) en la posición 89 y arginina (R) en la posición 108 (numeración de AHo).

PDF original: ES-2677003_T3.pdf

Anticuerpos, kit y método in vitro para detectar beta-oligómeros amiloides.

(11/04/2018). Solicitante/s: ACUMEN PHARMACEUTICALS, INC. Inventor/es: ZHAO,WEI-QIN, GOURE,WILLIAM F, XU,MIN, GASPAR,RENEE C, SHUGHRUE,PAUL J, WANG,FUBAO, WANG,WEIRONG, ZHANG,NINGYAN, MCCAMPBELL,ALEXANDER, SAVAGE,MARY J, WOLFE,ABIGAIL L.

Un kit para detectar oligómeros de beta-amiloides, que comprende: (a) un anticuerpo de captura que tiene una región variable de cadena ligera con una CDR1 que tiene la secuencia Arg-Ser-Ser-Gln-Ser-Ile-Val-His-Ser-Asn-Gly-Asn-Thr-Tyr-Leu-Glu (SEQ ID NO:14), una CDR2 que tiene la secuencia Lys-Ala-Ser-Asn-Arg-Phe-Ser (SEQ ID NO:15), y una CDR3 que tiene la secuencia Phe-Gln-Gly-Ser-Arg- Leu-Gly-Pro-Ser (SEQ ID NO:16); y una región variable de cadena pesada con una CDR1 que tiene la secuencia Gly-Phe-Thr-Phe-Ser-Ser-Phe-Gly-Met-His (SEQ ID NO:4), una CDR2 que tiene la secuencia Tyr-Ile-Ser-Arg-Gly- Ser-Ser-Thr-Ile-Tyr-Tyr-Ala-Asp-Thr-Val-Lys-Gly (SEQ ID NO:5), y una CDR3 que tiene la secuencia Gly-Ile-Thr-Thr- Ala-Leu-Asp-Tyr (SEQ ID NO:6); y (b) un anticuerpo de detección que reconoce un epitopo lineal N-terminal del péptido beta-amiloide 1-42 que es 82E1.

PDF original: ES-2666840_T3.pdf

Composición farmacéutica para el tratamiento y/o la profilaxis del cáncer.

(04/04/2018). Solicitante/s: TORAY INDUSTRIES, INC.. Inventor/es: OKANO, FUMIYOSHI, SAITO,TAKANORI, KOBAYASHI,SHINICHI, MINAMIDA,YOSHITAKA.

Un anticuerpo o un fragmento del mismo que tienen reactividad inmunológica con una proteína CAPRIN-1, comprendiendo el anticuerpo o el fragmento del mismo una región variable de cadena pesada que comprende regiones determinantes de la complementariedad de las SEQ ID NOs: 5, 6 y 7 y una región variable de cadena ligera que comprende regiones determinantes de la complementariedad de las SEQ ID NOs: 9, 10 y 11.

PDF original: ES-2672695_T3.pdf

Promotor derivado de un gen humano.

(21/03/2018). Solicitante/s: DAIICHI SANKYO COMPANY, LIMITED. Inventor/es: MURAKAMI, KENJI.

Un polinucleótido promotor que comprende una secuencia de nucleótidos representada por la SEQ ID NO: 1 en el listado de secuencias.

PDF original: ES-2670894_T3.pdf

Reducción de niveles de galectina-3 mediante plasmaféresis.

(28/02/2018) Una molécula de unión a galectina-3 (gal-3) para su uso en un método de tratamiento (a) del cáncer; o (b) de la fibrosis; o (c) de la inflamación dañina en un mamífero en el que el mamífero, respectivamente, (a) necesita la inhibición del crecimiento o la propagación del cáncer mediados al menos en parte por gal-3; o (b) necesita la inhibición del desarrollo o la extensión de la fibrosis mediada por gal-3; o (c) necesita la inhibición de la inflamación mediada por gal-3; comprendiendo dicho método: la realización de plasmaféresis en la sangre de un mamífero que necesita la reducción de los niveles circulantes de gal-3 para reducir los niveles circulantes de gal-3 activa, en el que dicha plasmaféresis se…

Producción de factor de coagulación IX con patrón de glucosilación mejorado.

(21/02/2018). Solicitante/s: WYETH LLC. Inventor/es: LASKO,DANIEL R, KOZA,STEPHAN M.

Un procedimiento de producción de factor de coagulación IX con un patrón de glucosilación mejorado en un cultivo celular, que comprende: cultivar células de mamífero que contienen un gen que codifica un factor de coagulación IX en un medio de cultivo celular que comprende manganeso entre 10 nM y 600 nM en las condiciones y durante el tiempo suficientes para permitir la expresión del factor de coagulación IX, en el que el patrón de glucosilación del factor de coagulación IX expresado es más amplio que el patrón de glucosilación observado en unas condiciones por lo demás idénticas en un medio por lo demás idéntico que carezca de manganeso, en el que un patrón de glucosilación más amplio es un mayor número de restos de azúcar unidos covalentemente en la cadena de oligosacárido.

PDF original: ES-2668212_T9.pdf

PDF original: ES-2668212_T3.pdf

Un método de tratamiento del trastorno obsesivo compulsivo (TOC) o la ansiedad usando un anticuerpo que se une a la anexina-1.

(14/02/2018). Solicitante/s: Queen Mary And Westfield College, University Of London. Inventor/es: PERRETTI, MAURO, D\'ACQUISTO,FULVIO.

Una molécula de unión específica que se une a la anexina-1 (Anx-A1) para su uso en el tratamiento del trastorno obsesivo compulsivo (TOC) o la ansiedad, en la que la molécula de unión específica es un anticuerpo o fragmento del mismo.

PDF original: ES-2670999_T3.pdf

Procedimiento de aislamiento de anticuerpos humanos.

(31/01/2018) Procedimiento para producir un anticuerpo humano o fragmento de unión del mismo con especificidad deseada caracterizado por el aislamiento de células B de cultivos oligoclonales a corto plazo de células B activadas que secretan anticuerpos de isotipo IgG que comprende las siguientes etapas en la secuencia: (a) seleccionar células B de memoria que expresan anticuerpos contra una proteína de interés de una o más muestras biológicas en base a la expresión de al menos un marcador de membrana de la superficie celular y/o de unión a antígeno, en el que dicha muestra biológica deriva de un paciente que sufre de síndrome de poliendocrinopatía autoinmune de tipo 1 (APS-1)/poliendocrinopatía autoinmune-candidiasis-distrofia ectodérmica (APECED), y en el…

Biomarcadores.

(24/01/2018). Solicitante/s: Otago Innovation Limited. Inventor/es: PEMBERTON,CHRISTOPHER JOSEPH, RICHARDS,ARTHUR MARK, NICHOLLS,MICHAEL GARY, YANDLE,TIMOTHY GRANT.

Un anticuerpo de fragmento de péptido señal de insulina o fragmento de unión a antígeno aislado que se une a un fragmento de péptido señal de insulina como se muestra en la SEQ ID NO: 16.

PDF original: ES-2666725_T3.pdf

Fusiones de anticuerpos con doble especificidad.

(24/01/2018) Una proteína de fusión de anticuerpos con doble especificidad que comprende un fragmento Fab o Fab' de anticuerpo con especificidad para un antígeno de interés, estando dicho fragmento genéticamente fusionado a dos anticuerpos de un solo dominio que tienen especificidad para albúmina sérica humana, en donde un anticuerpo de un solo dominio se fusiona al C terminal de la cadena ligera del fragmento Fab o Fab' mediante un ligante y el otro anticuerpo de un solo dominio se fusiona al C terminal de la cadena pesada del fragmento Fab o Fab' mediante un ligante y en donde un anticuerpo de un solo dominio es un dominio VH y el otro anticuerpo de…

Métodos y reactivos para crear anticuerpos monoclonales.

(17/01/2018) Un método para obtener secuencias de nucleótidos o secuencias de aminoácidos de cadenas pesadas o ligeras de inmunoglobulinas que se unen específicamente a un antígeno, que comprende: (a) proporcionar secuencias de ácido nucleico que codifican cadenas de inmunoglobulina o regiones variables de las mismas de al menos un animal de una especie seleccionada; (b) obtener una población de inmunoglobulinas policlonales de un animal de dicha especie seleccionada de la etapa (a) que se une específicamente a un antígeno, y obtener información de los espectros de masas de fragmentos peptídicos de cadenas pesadas o cadenas ligeras o regiones variables de las mismas de dicha población; (c) correlacionar la información de espectros de masas de los fragmentos…

Anticuerpo humanizado antioligómero de amiloide-beta.

(10/01/2018). Solicitante/s: KYOWA HAKKO KIRIN CO., LTD.. Inventor/es: SUZUKI, NOBUYUKI, KUBOTA,TSUGUO.

Anticuerpo humanizado que no se une a un monómero de proteína amiloide ß y se une a un oligómero de proteína amiloide ß, en el que la región variable de cadena pesada de anticuerpo comprende la secuencia de aminoácidos representada por la SEC ID nº: 12 y la región variable de cadena ligera de anticuerpo comprende la secuencia de aminoácidos representada por la SEC ID nº: 14.

PDF original: ES-2661601_T3.pdf

Anticuerpos antisulfátidos y proteoglicanos antisulfatados y su uso.

(03/01/2018) La presente invención está relacionada con el campo de la biotecnología Y particularmente con nuevos productos para ser usados en la salud humana. La presente invención proporciona nuevos anticuerpos monoclonales que reconocen de manera específica y con alta afinidad sulfátidos y proteoglicanos sulfatados. Los anticuerpos anti-sulfátidos y anti-proteoglicanos sulfatados descritos en la presente memoria descriptiva, proporcionan importantes agentes diagnósticos y terapéuticos para actuar sobre procesos patológicos asociados a la aparición de placas ateroscleróticas. Según esto, la invención proporciona composiciones farmacéuticas que comprenden los anticuerpos monoclonales de la invención o los fragmentos derivados de estos anticuerpos para su…

Anticuerpo monoclonal anti-VEGF y composición farmacéutica que comprende dicho anticuerpo.

(03/01/2018). Solicitante/s: Jiangsu Simcere Pharmaceutical Co., Ltd. Inventor/es: LI,PIERRE, KE,YAOHUANG, ZHANG,YONGKE, ZHU,WEIMIN, YU,GUOLIANG, MA,FANXIN, FAN,XIN.

Un anticuerpo monoclonal que se une específicamente a VEGF, caracterizado porque el dominio variable de su cadena pesada comprende secuencias de aminoácidos de CDR 1-3 que consisten respectivamente en la SEQ ID NO. 1, SEQ ID NO. 2 y SEQ ID NO. 3, y el dominio variable de su cadena ligera comprende secuencias de aminoácidos de CDR 1-3 que consisten respectivamente en SEQ ID NO. 4, SEQ ID NO. 5 y SEQ ID NO. 6.

PDF original: ES-2657226_T3.pdf

1 · · 3 · 6 · 11 · ››