37 patentes, modelos y diseños de Biogen MA Inc

Composiciones y métodos para la modulación de corte y empalme de SMN2 en un sujeto.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(13/02/2019). Inventor/es: CHENG, SENG, H., KLINGER, KATHERINE, W., BENNETT, C., FRANK, SHIHABUDDIN,LAMYA, KRAINER,ADRIAN R, HUA,YIMIN, PASSINI,MARCO A, HUNG,GENE, RIGO,FRANK. Clasificación: A61K31/7088, C12N15/113.

Un compuesto antisentido que comprende oligonucleótido antisentido complementario al intrón 7 de un pre-ARNm que codifica SMN2 humano, para su uso en el tratamiento de un sujeto humano que tiene atrofia muscular espinal (SMA), donde el compuesto se administra en el líquido cefalorraquídeo en el espacio intratecal del sujeto humano, donde el oligonucleótido antisentido tiene una secuencia de nucleobases que consiste en la secuencia de nucleobases de SEQ ID NO: 1, donde cada nucleósido del oligonucleótido antisentido comprende un resto de azúcar modificado, donde cada resto de azúcar modificado es un resto de azúcar 2'-metoxietilo y donde cada enlace internucleosídico es un enlace de fosforotioato.

PDF original: ES-2699827_T3.pdf

Anticuerpos anti-alfavbeta6 y usos de los mismos.

(13/02/2019) Un anticuerpo humanizado o fragmento de unión a antígeno del mismo que se une específicamente a αvβ6, que comprende: (i) un dominio variable de cadena pesada que comprende la secuencia de aminoácidos de la SEQ ID NO: 72 y un dominio variable de cadena ligera que comprende la secuencia de aminoácidos de la SEQ ID NO: 68; (ii) un dominio variable de cadena pesada que comprende la secuencia de aminoácidos de la SEQ ID NO: 72 y un dominio variable de cadena ligera que comprende la secuencia de aminoácidos de la SEQ ID NO: 69; (iii) un dominio variable de cadena pesada que comprende la secuencia de aminoácidos de la SEQ ID NO: 73 y un dominio…

Derivados de naftaleno 1,5,6-sustituidos como moduladores de receptor de 1-fosfato de esfingosina (S1P) y/o autotaxina (ATX) para tratar trastornos inflamatorios y autoinmunitarios.

(28/11/2018) Un compuesto representado por la fórmula estructural (II) o (III):**Fórmula** o una sal farmacéuticamente aceptable del mismo, donde: X es O, S(O)r, NR12, C(O) o CH2; R1 es un ciclohexilo que está opcionalmente sustituido con uno a tres R6 independientemente seleccionados; R2, para cada aparición, se selecciona independientemente de entre el grupo consistente en hidrógeno, halógeno, hidroxilo, nitro, ciano, carboxi, alquilo C1-6, halogenoalquilo C1-6, cicloalquilo C3-8, halogenocicloalquilo C3-8, alcoxi C1-6, halogenoalcoxi C1-6, cicloalcoxi C3-8, halogenocicloalcoxi C3-8, alcanoílo C1-6, amino, N-(alquil C1-6)amino, N,N-di-(alquil C1-6)amino, alcoxi C1-6-carbonilo, alcanoiloxi C1-6, carbamoílo, N-(alquil C1-6)carbamoílo, N,N-di-(alquil…

Antagonista de VLA-1 para su utilización en el tratamiento de un accidente cerebrovascular.

Sección de la CIP Necesidades corrientes de la vida

(11/10/2018). Inventor/es: RELTON,JANE,K, GARDNER,HUMPHREY. Clasificación: A61K39/395, A61K38/19, A61P9/10, A61K38/49.

Antagonista de VLA-1 para su utilización en la prevención de un accidente cerebrovascular en un sujeto, en el que el sujeto ha experimentado un ataque isquémico transitorio (AIT), en el que el antagonista de VLA-1 es un anticuerpo anti-VLA-1 o fragmento de unión a antígeno del mismo.

PDF original: ES-2685802_T3.pdf

Derivados del ácido 2-(1-(1-(6-((ciclohexil)oxi)-5-(trifluorometil)naftalen-2-il)etil)piperidin-3-il)acético como moduladores de la autotaxina (atx) para el tratamiento de inflamaciones y trastornos autoinmunes.

(05/10/2018) Un compuesto representado por la fórmula (I): **(Ver fórmula)** o una sal farmacéuticamente aceptable del mismo, en el que: X1, X2 y X3 son CH; o uno de X1, X2 o X3 es N y los otros dos son CH; R2 es un haloalquilo C1-4 o ciano; R3 es -L1-J-L2-R12 y R4 es hidrógeno o un alquilo C1-6; o R3 y R4 junto con el nitrógeno al que están unidos son un heterociclilo de 3 a 8 miembros que está sustituido con -L2-R12, y está opcionalmente sustituido con un halo, hidroxilo, amino o un alquilo C1-6; R5 es un halo, un alquilo C1-6 o un haloalquilo C1-6; R6 y R7 son cada uno independientemente hidrógeno, alquilo C1-6, haloalquilo C1-6, cicloalquilo C3-7 o COOH; o R6 y R7 junto con el carbono al que están unidos son -C(≥O)-, un espirocicloalquilo C3-8 o un espiroheterocicloalquilo de 3 a 8 miembros; …

Inhibidores de pirimidinil tirosina quinasa.

(02/10/2018) Un compuesto de fórmula I:**Fórmula** o una sal farmacéuticamente aceptable de este, en donde: cada R1 es independientemente hidrógeno, un grupo alifático C1-6 opcionalmente sustituido, un grupo heterocíclico monocíclico, de 3-7 miembros, opcionalmente sustituido, o un grupo heterociclilalquilo opcionalmente sustituido que tiene 3-7 átomos de carbono y 1-3 heteroátomos seleccionados independientemente de nitrógeno, oxígeno o azufre; o dos grupos R1 se toman junto con sus átomos interventores para formar un anillo heterocíclico monocíclico, saturado o parcialmente insaturado, de 3-7 miembros, opcionalmente sustituido que tiene 1-2 heteroátomos seleccionados independientemente de nitrógeno,…

Formulación de inmunoglobulina y procedimiento de preparación de la misma.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Construcciones fijas

(30/05/2018). Inventor/es: BURKE, DAVID J., LEHRMAN, SHERWOOD, RUSS, PHILLIPS,CHRISTOPHER, CALLAWAY,JAMES, BUCKLEY,SHAUN E, O'CONNOR,BARBARA HORSEY. Clasificación: A61K39/00, C07K1/00, A61K39/395, E21B43/12, E21B43/08.

Una formulación acuosa estable que comprende 20 mg/ml de natalizumab, tampón fosfato 10 mM, polisorbato 80 al 0,02 % (p/v) y cloruro sódico 140 mM, donde la formulación tiene un pH de 6,0 ± 0,5.

PDF original: ES-2676544_T3.pdf

Mejora del transporte de moléculas terapéuticas a través de la barrera hematoencefálica.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(25/04/2018). Inventor/es: FARRINGTON,GRAHAM K, SISK,WILLIAM. Clasificación: C07K16/28, A61P25/00, C07K16/46, A61K47/68.

Una molécula de unión que es una proteína quimérica que comprende al menos un agente farmacológicamente activo, al menos dos sitios de unión comprendidos en anticuerpos de dominio único que se unen a TMEM30A, y una región Fc que comprende un primer resto Fc y un segundo resto Fc, donde al menos dos sitios de unión que se unen a TMEM30A se fusionan cada uno i) directamente o ii) mediante una secuencia de aminoácidos intermedia al extremo N-terminal del primer resto Fc y el segundo resto Fc, respectivamente, donde la región Fc se une específicamente al receptor de FcRn.

PDF original: ES-2677111_T3.pdf

Compuestos de biarilo útiles para el tratamiento de enfermedades humanas en oncología, neurología e inmunología.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(18/04/2018). Inventor/es: KOCH, KEVIN, LYSSIKATOS, JOSEPH P., MIAO, HUA, KUMARAVEL,GNANASAMBANDAM, ZHANG,LEI, HOPKINS,Brian T, MA,BIN, SUN,LIHONG, CHAN,TIMOTHY RAYMOND. Clasificación: C07D401/14, A61P35/00, A61K31/505, A61K31/506, A61K31/44, A61P25/02, A61P37/00, C07D495/04, C07D417/12, C07D403/12, C07D409/14, C07D413/14, C07D417/14, C07D513/04.

Un compuesto de fórmula I-21: **Fórmula** o una sal farmacéuticamente aceptable de este.

PDF original: ES-2678021_T3.pdf

Anticuerpos Sp35 y usos de los mismos.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(28/03/2018). Inventor/es: PEPINSKY, R., BLAKE, MI, SHA, SHAO,ZHAOHUI, MIKLASZ,STEVEN D, GRAFF,CHRISTILYN, GARBER STARK,ELLEN A. Clasificación: C07H21/00, A61K39/00, C07K14/00, C12N15/13, C07K16/28, A61K39/395, A61K31/70, C07K16/00, A61P25/00, C12N5/20, A61K38/16, C12N15/113.

Un anticuerpo aislado que puede unirse específicamente al polipéptido Sp35 humano (SEQ ID NO: 2), donde el anticuerpo comprende: una región VH que comprende las secuencias CDR1, CDR2 y CDR3 de VH indicadas en SEQ ID NO: 436, SEQ ID NO: 437 y SEQ ID NO: 438, respectivamente; y una región VL que comprende las secuencias CDR1, CDR2 y CDR3 de VL indicadas en SEQ ID NO: 442, SEQ ID NO: 443 y SEQ ID NO: 444, respectivamente, donde el anticuerpo se une al polipéptido Sp35 con una afinidad caracterizada por una constante de disociación no mayor que 5 x 10-10 M medido mediante FACS en células CHO transfectadas de forma estable con Sp35 humano, y donde el anticuerpo es IgG1/kappa.

PDF original: ES-2673153_T3.pdf

Derivados de ácido 1-[7-(cis-4-metil-ciclohexiloxi)-8-trifluorometil-naftalen-2-ilmetil]-piperidin-4-carboxílico como moduladores de autotaxina (ATX) para tratar inflamaciones y trastornos autoinmunitarios.

(28/02/2018) Un compuesto representado por la fórmula (III): **(Ver fórmula)** o una sal farmacéuticamente aceptable del mismo, en la que R3 es hidrógeno, un halógeno, haloalquilo C1-6 o ciano, a condición de que cuando R3 sea hidrógeno, R1 es un cicloalquilo C3-8 que está opcionalmente sustituido con de 1 a 6; R5 es un cicloalquileno C1-6, carbociclilo C3-8, un heterociclilo de 3 a 8 miembros, arilo C6-10, un heteroarilo de 5 a miembros, un sistema de anillos unidos por puente que comprende de 6 a 12 miembros de anillo, un sistema de anillos espiro que comprende de 5-14 miembros de anillo, o un sistema de anillos bicíclicos representado por la siguiente fórmula: **(Ver fórmula)** en la que B' y B" están seleccionados independientemente del grupo que consiste en carbociclilo C3-8 monocíclico, un heterociclilo de 3 a 8 miembros…

Procedimiento para reducir los síntomas similares a gripe asociados a la administración intramuscular de interferón usando un régimen de dosificación creciente de titulación rápida.

Sección de la CIP Necesidades corrientes de la vida

(24/01/2018). Inventor/es: DEYKIN,AARON. Clasificación: A61K38/21, A61P25/28.

Interferón ß-1a para uso en la reducción de la gravedad de los síntomas similares a gripe en un paciente que tiene esclerosis múltiple tratado con interferón ß-1a administrado por vía intramuscular durante un periodo de 8 semanas, donde el medicamento se va a administrar por vía intramuscular una vez por semana a un paciente que tiene esclerosis múltiple de acuerdo con un primer programa, que comprende: administración intramuscular de 7,5 μg de interferón ß-1a por el paciente en la semana 1; administración intramuscular de 15 μg de interferón ß-1a por el paciente en la semana 2; administración intramuscular de 22,5 μg de interferón ß-1a por el paciente en la semana 3; y administración intramuscular de 30 μg de interferón ß-1a por el paciente en la semana 4 y cada semana después de ello.

PDF original: ES-2666850_T3.pdf

Compuestos que son agentes moduladores de S1P y/o agentes moduladores de ATX.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(03/01/2018). Inventor/es: MI, SHA, KUMARAVEL,GNANASAMBANDAM, ZHANG,LEI, PENG,HAIRUO, XIN,ZHILI, MA,BIN, GUCKIAN,KEVIN, SUN,LIHONG, SHAO,ZHAOHUI, TAVERAS,ARTHUR. Clasificación: A61K31/435, A61P17/06, A61P37/06, A61P29/00, A61K31/4545, C07D401/04, A61P19/02, A61K31/4709, C07D239/42, A61K31/439, C07D215/20, C07D213/74, C07D205/04, C07D217/22, A61K31/4725, C07C229/00, C07D491/10, C07D451/00, C07D451/14.

Un compuesto representado por la fórmula (IIa):**Fórmula** o una sal farmacéuticamente aceptable del mismo, en la que: A3c y A5c son N o CH, con la condición de que solamente uno de A3c o A5c sea N; R9 es un halo, un alquilo C1-6, o un haloalquilo C1-6; R13 y R14 son cada uno independientemente hidrógeno o un alquilo C1-6; R2a es un halo, haloalquilo C1-6 o ciano; cada R3 y cada R4 son cada uno independientemente hidrógeno, un carboxi, alquilo C1-6, o un alquenilo C2- 6; o R3 y R4 junto con el carbono al que están unidos son -C(≥O)-, un espirocicloalquilo C3-8, o un espiroheterocicloalquilo de 3 a 8 miembros; (i) m es 1;**Fórmula** se representa por la siguiente fórmula:**Fórmula** y R5 es CO2H; o (ii) m es 0;**Fórmula** se representa por la siguiente fórmula:**Fórmula** donde B está opcionalmente sustituido adicionalmente por oxo, hidroxi, -NH2, -CONH2, o -CO2H; y R5 es CO2H.

PDF original: ES-2671194_T3.pdf

Métodos para el tratamiento de enfermedades inflamatorias y autoinmunes con natalizumab.

(20/12/2017) Natalizumab para su uso en un método para tratar una enfermedad inflamatoria o autoinmune, donde dicho método comprende: (a) administrar una primera dosis de natalizumab durante un primer período de administración; (b) controlar la cantidad de natalizumab bivalente en el plasma o suero del paciente durante el primer período de administración; (c) determinar una segunda dosis de natalizumab en base al nivel de natalizumab bivalente observado; y (d) administrar una segunda dosis de natalizumab durante un segundo período de administración; donde si el control muestra que la cantidad de natalizumab…

Ensayos relacionados con anti-VLA-4.

Sección de la CIP Física

(13/12/2017). Inventor/es: HOCHMAN, PAULA, S., PLAVINA,TATIANA, LERNER,MICHAELA. Clasificación: G01N33/68, G01N33/558, G01N33/94.

Procedimiento para analizar el nivel de un anticuerpo IgG4 humanizado anti-VLA-4 , el procedimiento comprende: a) poner en contacto una muestra biológica obtenida de un sujeto con un agente de captura asociado con un sustrato, donde el agente de captura puede unirse a un anticuerpo IgG4 humanizado anti-VLA-4 en la muestra para formar un complejo y donde el sustrato es una porción de un sistema inmunocromatográfico de flujo lateral; y b) detectar la unión del agente de captura al anticuerpo IgG4 anti-VLA-4 con un agente secundario que se une a dicho complejo en el sistema inmunocromatográfico de flujo lateral y determinar si el nivel de anticuerpo IgG4 humanizado anti-VLA-4 es superior o inferior a un nivel predeterminado en base a la detección; donde el agente de captura es un anticuerpo o un fragmento de unión al antígeno del mismo y el agente secundario se selecciona de entre (i) un anticuerpo anti-IgG4 o (ii) un anticuerpo anti-anti-VLA-4.

PDF original: ES-2666372_T3.pdf

Ensayo para anticuerpos contra el virus jc.

(29/11/2017) Un procedimiento "in vitro" que comprende: (a) contactar la muestra con partículas similares a las virales altamente purificadas (HPVLP, siglas en inglés) que consisten principalmente en la proteína VP1 del virus JC (VJC), en solución bajo condiciones adecuadas para la unión de un anticuerpo contra VJC en la muestra con una HPVLP, de esta forma proporcionando una muestra preincubada; (b) contactar la muestra preincubada con una HPVLP, que consiste principalmente en una proteína VP1 del VJC, inmovilizada en un sustrato sólido bajo condiciones adecuadas para la unión de un anticuerpo contra VJC en la muestra con una HPVLP; (c) detectar el nivel de anticuerpo contra VJC en la unión de muestra preincubada con las HPVLP…

Procedimiento de preparación de fumarato de dimetilo cristalino y de alta pureza.

Sección de la CIP Química y metalurgia

(15/11/2017). Inventor/es: GUZOWSKI,JOHN, KIESMAN,WILLIAM, IRDAM,ERWIN. Clasificación: C07C67/08, C07C69/60, C07C67/52.

Procedimiento de preparación de fumarato de dimetilo, que comprende: hacer reaccionar: (a) ácido fumárico; y (b) metanol; en presencia de ácido sulfúrico; en una proporción de metanol a ácido fumárico de aproximadamente 5,7 a aproximadamente 8,6 litros de metanol por kilogramo de ácido fumárico; en una mezcla de reacción para obtener una mezcla de productos que comprende una baja concentración de sulfato de dimetilo, donde la concentración de sulfato de dimetilo es inferior a 4,0 ppm; donde el término "aproximadamente" se usa para indicar el número dado más o menos del 1 al 10 %.

PDF original: ES-2659771_T3.pdf

Métodos para determinar diferencias en la actividad de la alfa-4-integrina mediante la correlación de las diferencias en los niveles de sVCAM y/o sMAdCAM.

(04/10/2017) Un método para determinar in vitro una diferencia en la actividad alfa-4-integrina en un individuo con una enfermedad o un trastorno seleccionado entre el grupo que consiste en esclerosis múltiple y enfermedad inflamatoria del intestino, que comprende: a) medir una molécula soluble en una primera muestra biológica obtenida de un fluido corporal del individuo, seleccionada del grupo que consiste en sangre, suero y plasma, inmediatamente antes de la administración de un inhibidor de alfa-4-integrina; b) medir la molécula soluble en una segunda muestra biológica, en donde la segunda muestra biológica se ha obtenido de un fluido corporal del individuo seleccionada del grupo que consiste en sangre, suero y plasma, en un plazo de treinta y un…

Conjugados poliméricos de interferón beta-1a y usos de los mismos.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(30/08/2017). Inventor/es: WHITTY, ADRIAN, RUNKEL, LAURA, BRICKELMAIER, MARGOT, HOCHMAN, PAULA, PEPINSKY, BLAKE. Clasificación: A61P35/00, A61K39/395, C07K19/00, A61P43/00, C07K16/00, A61P37/00, A61K38/21, A61P9/00, A61P31/12, A61K38/19, A61P29/00, A61P1/16, C07K14/565, A61K47/50, A61K47/61, A61K47/58.

Una composición que comprende un interferón-beta-1a o una proteína de fusión que comprende dicho interferón-beta-1a,donde el interferón-beta-1a consiste en la secuencia de aminoácidos **Fórmula** y donde dicho interferón-beta-la está acoplado a un único polímero de origen no natural en el extremo N-terminal de dicho interferón-beta-la, comprendiendo dicho polímero un dextrano, polivinilpirrolidona, poliacrilamida, o alcohol polivinílico.

PDF original: ES-2653589_T3.pdf

Métodos para evaluar una respuesta inmune a un agente terapéutico.

Sección de la CIP Física

(14/06/2017). Inventor/es: WAKSHULL, ERIC, SUBRAMANYAM,MEENA, AMARAVADI,LAKSHMI, LYNN,FRANCES, PANZARA,MICHAEL, BARBOUR,ROBIN MCDAID, TAYLOR,JULIE ELIZABETH. Clasificación: G01N33/68.

Un método para detectar una respuesta inmune clínicamente significativa de un anticuerpo de unión a VLA-4 en un sujeto, comprendiendo el método determinar si una muestra biológica de un sujeto a quien se ha administrado un anticuerpo de unión a VLA4 contiene al menos un nivel umbral, clínicamente significativo, de 500 ng/ml de un anticuerpo soluble que se une al anticuerpo de unión a VLA-4, donde la presencia de al menos el nivel umbral del anticuerpo soluble es indicativa de una disminución de la eficacia o la falta de eficacia del anticuerpo de unión a VLA-4.

PDF original: ES-2640295_T3.pdf

Agentes moduladores de S1P y/o ATX.

(07/06/2017) Un compuesto representado por la fórmula (I): **Fórmula** o una sal farmacéuticamente aceptable del mismo, donde: X es -O-, -S(O)r-, -CH2- o -NR-, donde r es 0, 1 o 2; X1, X2 y X5 son cada uno independientemente CR7 o N; uno de X3 o X4 es C y está enlazado por un enlace sencillo con -L-, y el otro es CR7 o N, a condición de que no más de tres de X1, X2, X3, X4 o X5 sean N; el anillo A es cicloalquilo C5-6 monocíclico o un heterociclo monocíclico de 5 a 6 miembros que comprende de 1 a 5 heteroátomos independientemente seleccionados de N, S u O; donde el anillo A está opcionalmente sustituido además con 1 a 3 R4; a condición de que el anillo A no sea morfolinilo, tiomorfolinilo o tetrahidro-2H-piranilo;…

Conjugados poliméricos de interferón beta-1a y usos de los mismos.

Sección de la CIP Necesidades corrientes de la vida

(17/05/2017). Inventor/es: WHITTY, ADRIAN, RUNKEL, LAURA, BRICKELMAIER, MARGOT, HOCHMAN, PAULA, PEPINSKY, BLAKE. Clasificación: A61P35/00, A61K38/21, A61P31/12, A61K47/60.

1. Una composición que comprende un interferón-beta-1a o una proteína de fusión que comprende el interferón-beta-1a, donde el interferón-beta-1a consiste en la secuencia aminoacídica: 2. MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALT IYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKL MSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN, y donde el interferón-beta-1a está acoplado a un único polímero de origen no natural en el extremo N-terminal de dicho interferón-beta-1a, comprendiendo dicho polímero un resto de polialquilenglicol.

PDF original: ES-2630278_T3.pdf

Anticuerpos contra VLA-4.

(12/04/2017) Una molécula de anticuerpo recombinante o un fragmento de la misma que se une a α4 que comprende una cadena pesada variable y una cadena ligera variable, en la que: (a) la cadena pesada variable comprende la secuencia del armazón de la cadena pesada variable de IGHV1-f y las CDR de la cadena VH del anticuerpo murino HP1/2, en la que CDR1 comprende la secuencia GFNIKDTYM, CDR2 comprende la secuencia RIDPASGDTKYDPKFQV y CDR3 comprende la secuencia GMWVSTGYALDF; y (b) la cadena ligera variable comprende la secuencia del armazón de la cadena ligera variable de IGKV4-1 y las CDR de la cadena VL del anticuerpo murino HP1/2, en la que CDR1 comprende la secuencia KASQSVTNDVA, CDR2 comprende la secuencia YASNRYT y CDR3 comprende la secuencia QQDYSSPYT, en la que: …

Análogos heterobicíclicos de 1-fosfato de esfingosina.

(07/12/2016) Un compuesto de fórmula (I): **Fórmula** donde: A1 es -C(X1)≥, -N≥, -O- o -S-; A2 es -C(X2)≥, -N≥, -O- o -S-; A3 es -C(X3)(X3')-, -C(X3)≥, -NX3-, -N≥, -0- o -S-; A4 es -C(X4)(X4')-, C(X3)≥, -NX4-, -N≥ u -O-; A5 es -C(X5)(X5')-, -C(X5)≥, -NX5-, -N≥ -O- o -S-; A6 es -C(X6)≥, -N≥, -O- o -S-; a condición de que A1, A2, A3, A4, A5 y A6 no sean simultáneamente -C(X1)≥, -C(X2)≥, -C(X3)≥, -C(X4)≥, -C(X5)≥ y -C(X6)≥ respectivamente, y a condición de que el anillo bicíclico incluya 0-3 heteroátomos; X1 es hidrógeno, halógeno, hidroxi, nitro, ciano, alquilo, halogenoalquilo, cicloalquilo, halogenocicloalquilo, alcoxi,…

Anticuerpos de unión a Tweak.

(19/10/2016) Una proteína aislada que comprende una secuencia de dominio variable de cadena pesada y una secuencia de dominio variable de cadena ligera que pueden formar un sitio de unión a antígeno que se une al inductor débil de la apoptosis del tipo TNF humano (TWEAK), donde la secuencia de dominio variable de cadena pesada de la proteína comprende regiones armazón que son al menos el 95% idénticas a las regiones armazón de la secuencia de aminoácidos mostrada en la SEQ ID NO: 59; y donde la secuencia de dominio variable de cadena ligera de la proteína comprende regiones armazón que son al menos el 95% idénticas a las regiones armazón de la secuencia de aminoácidos mostrada en la SEQ ID NO: 61 o 63, y donde la proteína comprende las siguientes regiones determinantes de la complementariedad (CDR): CDRH1 que consiste…

Neuroprotección en enfermedades desmielinizantes.

Sección de la CIP Necesidades corrientes de la vida

(21/09/2016). Inventor/es: GOLD,RALF. Clasificación: A61P25/00, A61K31/225.

Al menos un compuesto elegido de dimetilfumarato y monometilfumarato, o una sal farmacéuticamente aceptable de los mismos, para su uso en el tratamiento de una forma progresiva de esclerosis múltiple en un sujeto.

PDF original: ES-2599227_T3.pdf

Procedimiento para suministrar interferón beta.

Sección de la CIP Necesidades corrientes de la vida

(24/08/2016). Inventor/es: FAULKNER,ERIC ANTHONY, DI BIASE,MARY DIANA. Clasificación: A61K9/00, A61K38/21, A61J1/00, A61M5/31.

Un procedimiento para la producción de un dispositivo que incluye un alojamiento para contener una solución de interferón β, donde el procedimiento comprende: (a) la limpieza del alojamiento con lavados ácidos y básicos de manera que se elimina o se reduce la cantidad de metal de agregación en la superficie que, en uso, estaría en contacto directo con la solución de interferón β; (b) el llenado del alojamiento con solución de interferón β, donde, después del llenado con la solución, el alojamiento libera una concentración de metal de agregación en la solución de inferior a 500 partes por mil millones después de conservar la solución en el alojamiento durante más de aproximadamente 10 minutos.

PDF original: ES-2588583_T3.pdf

Agentes moduladores S1P.

(24/08/2016) Un compuesto seleccionado entre el grupo que consiste en: ácido 1-((6-(trans-4-terc-butilciclohexiloxi)-quinazolin-2-il)metil)piperidin-4-carboxílico; ácido 1-(1-(6-(trans-4-terc-butilciclohexiloxi)-naftalen-2-il)-2,2,2-trifluoroetil)piperidin-4-carboxílico; ácido 1-((6-(4-isopropilciclohexiloxi)naftalen-2-il)metil)piperidin-4-carboxílico; ácido 1-((6-(cis-4-terc-butilciclohexiloxi)-naftalen-2-il)metil)piperidin-4-carboxílico; ácido 1-((6-(4-trifluorometil)ciclohexiloxi)-naftalen-2-il)metil)piperidin-4-carboxílico; ácido 1-((6-(4-etilciclohexiloxi)naftalen-2-il)metil)piperidin-4-carboxílico; ácido 1-((6-(4-butilciclohexiloxi)naftalen-2-il)metil)piperidin-4-carboxílico;…

Anticuerpos anti-BCMA.

(27/07/2016) Un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une al polipéptido de la SEQ ID NO: 9, en el que el anticuerpo o fragmento de unión a antígeno comprende: a) un dominio variable de cadena pesada que comprende una región CDR1 que comprende los aminoácidos 31-35 de la SEQ ID NO: 3, una región CDR2 que comprende los aminoácidos 50-66 de la SEQ ID NO: 3, y una región CDR3 que comprende los aminoácidos 99-106 de la SEQ ID NO: 3; y un dominio variable de cadena ligera que comprende una región CDR1 que comprende los aminoácidos 24-38 de una cualquiera de las SEQ ID NO: 4, 11 o 12, una región CDR2 que comprende los aminoácidos…

Interferón-beta para su uso como monoterapia o en combinación con otras terapias contra el cáncer.

Sección de la CIP Necesidades corrientes de la vida

(22/06/2016). Inventor/es: BAKER, DARREN, P., WANG,XINZHONG, JOSEPH,INGRID B.J.K. Clasificación: A61P35/00, A61K38/21.

Interferón-beta-1a pegilado para su uso en un método de tratamiento de carcinoma de mama, donde el tratamiento comprende administrar dicho interferón-beta-1a pegilado a un sujeto en combinación con un inhibidor mitótico.

PDF original: ES-2587837_T3.pdf

Compuestos de polímero de polialquileno y usos de éstos.

(23/03/2016) Un conjugado que tiene la estructura según la Fórmula XXIIa: Fórmula XXIIa:**Fórmula** en la que P es un polímero de polialquilen glicol; X es O; Z es un grupo alquilo o heteroalquilo C1 a C20 de cadena lineal o ramificada, saturado o insaturado, alquilo cíclico o heteroalquilo cíclico C3 a C8 saturado o insaturado, un grupo arilo o heteroarilo sustituido o no sustituido o un alcarilo sustituido o no sustituido en el que el alquilo es un grupo alquilo o heteroalcarilo C1 a C20 saturado o insaturado, en el que los sustituyentes se seleccionan del grupo que consiste en halógeno, hidroxilo, carbonilo, carboxilato, éster, formilo, acilo, tiocarbonilo,…

Un anticuerpo monoclonal bloqueante frente a VLA-1 y su uso para el tratamiento de trastornos inflamatorios.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(28/01/2016). Ver ilustración. Inventor/es: KOTELIANSKI,VICTOR E, DE FOUGEROLLES,ANTONIN R. Clasificación: A61P35/00, C07K16/28, A61K39/395, A61P17/06, A61P1/04, A61P17/00, A61P27/16, A61P11/00, A61P25/00, A61P37/06, A61P3/10, A61P37/08, A61P7/02, A61P29/00, A61P9/10, A61P27/02, A61P17/02, A61P19/02, A61P1/06, A61P1/02, A61P21/04.

Un anticuerpo o un fragmento de dicho anticuerpo, capaz de 1) unirse a un dominio α1-I de VLA-1, y 2) capaz de inhibir la adhesión dependiente de K562-α1 al colágeno IV, para su uso en el tratamiento de un trastorno inflamatorio en una enfermedad vascular en un sujeto.

PDF original: ES-2557768_T3.pdf

1 · ››

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015