CIP 2015 : A61K 39/395 : Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.

CIP2015AA61A61KA61K 39/00A61K 39/395[1] › Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

A61K 39/395 · Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.

CIP2015: Invenciones publicadas en esta sección.

Anticuerpos que se unen a TL1A y sus usos.

(08/11/2018). Solicitante/s: GLENMARK PHARMACEUTICALS S.A.. Inventor/es: BLEIN,STANISLAS, SKEGRO,DARKO, ATTINGER,ANTOINE, BACK,JONATHAN ALBERT, LISSILAA,RAMI.

Un anticuerpo o fragmento del mismo que se une a TL1A humano, murino, de rata y de cynomolgus que comprende una CDR1 de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 51, una CDR2 de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 52, y una CDR3 de pesada cadena que comprende la secuencia de aminoácidos de SEQ ID NO: 53; y que comprende una CDR1 de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 54, una CDR2 de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 55, y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 56.

PDF original: ES-2689080_T3.pdf

Formulaciones con oxidación reducida.

(07/11/2018). Solicitante/s: F. HOFFMANN-LA ROCHE AG. Inventor/es: ALAVATTAM,SREEDHARA, MALLANEY,MARY, GREWAL,PARBIR.

Una formulación líquida que comprende una proteína y un compuesto que previene la oxidación de la proteína en la formulación líquida, en la que el compuesto se selecciona del grupo que consiste en 5-hidroxitriptófano, 5- hidroxiindol, 7-hidroxiindol, y serotonina, y en la que la proteína es un anticuerpo.

PDF original: ES-2688895_T3.pdf

Antagonistas del receptor 1 del factor de necrosis tumoral para tratar enfermedades respiratorias.

(07/11/2018). Solicitante/s: DOMANTIS LIMITED. Inventor/es: FITZGERALD, MARY F., SEPP,ARMIN, HOLMES,STEVE, WOOLVEN,BENJAMIN P, TOMLINSON,IAN M, LEE,JENNIFER, DE WILDT,RUDOLF M. T, WINTER,GREGORY P, FOX,JUSTIAN CRAIG.

El uso de un dominio variable único de inmunoglobulina que es un VH, VL o VHH que tiene al menos 96% de identidad a lo largo de su longitud completa, según se determina empleando el algoritmo BLAST, con la secuencia de aminoácidos TAR 2H-131-511 (SEQ ID NO:379), y que se une a TNFR1 en tejido pulmonar, para la fabricación de una formulación para la administración local al tejido pulmonar para tratar o prevenir una enfermedad respiratoria o la inflamación pulmonar, y en el que la administración local al tejido pulmonar es mediante inhalación o administración intranasal.

PDF original: ES-2688941_T3.pdf

Método para producir formulaciones sólidas que comprenden dominios variables individuales de inmunoglobulina.

(05/11/2018). Solicitante/s: ABLYNX N.V. Inventor/es: DE BRABANDERE,VERONIQUE, DEBUNNE,ANN.

Método de producción de una formulación sólida de un dominio variable individual de inmunoglobulina, que es un procedimiento de granulación en húmedo o un procedimiento de recubrimiento en el que se agita un material portador sólido y se pone en contacto con un líquido que comprende un dominio variable individual de inmunoglobulina como agente activo y simultáneamente se aplica calor para evaporar el líquido, en el que el método se realiza a una temperatura del material portador sólido puesto en contacto con el líquido que comprende un dominio variable individual de inmunoglobulina de entre 40 °C y 80 °C.

PDF original: ES-2688591_T3.pdf

Productos génicos de expresión diferencial en tumores y su uso.

(31/10/2018) Composición farmacéutica para su uso en un método para el tratamiento de una enfermedad de cáncer que se distingue por la expresión de un antígeno asociado a un tumor, que comprende uno o varios componentes seleccionados del grupo formado por: (i) un antígeno asociado a un tumor o una parte del mismo, (ii) un ácido nucleico que codifica un antígeno asociado a un tumor o una parte del mismo, (iii) un anticuerpo que se une a un antígeno asociado a un tumor, (iv) un ácido nucleico no codificante que hibrida de forma específica con un ácido nucleico que codifica un antígeno asociado a un tumor y (v) una célula huésped que…

Anticuerpos anti-HtrA1 y procedimientos de uso.

(30/10/2018). Solicitante/s: F. HOFFMANN-LA ROCHE AG. Inventor/es: KIRCHHOFER, DANIEL, LIANG,Wei-ching, WU,Yan, VAN LOOKEREN CAMPAGNE,MENNO, MORAN,PAUL M, LIPARI,MICHAEL TERRY, KATSCHKE,JR. KENNETH J, STAWICKI,SCOTT.

Un anticuerpo monoclonal aislado que se une a HtrA1 e inhibe su actividad serina proteasa para uno o mas sustratos para HtrA1, en el que el anticuerpo comprende una secuencia de VH que comprende la SEQ ID NO: 32 y una secuencia de VL que comprende la SEQ ID NO: 31.

PDF original: ES-2687951_T3.pdf

Moléculas multiespecíficas de unión a antígeno y uso de las mismas.

(30/10/2018) Una molécula multiespecífica de unión a antígeno que comprende: un primer dominio (D1) de unión a antígeno; y un segundo dominio (D2) de unión a antígeno; en la que D1 se une específicamente a una molécula diana (D) en la que D es una proteína o un polipéptido que se asocia a tumor preferentemente expresado en la superficie de una célula tumoral; y en la que D2 se une a una proteína efectora (E) de internalización que se expresa en la superficie de células tanto tumorales como no tumorales y en la que E experimenta internalización celular y se procesa mediante una ruta de degradación intracelular; en la que D2 se une a E con baja afinidad de tal manera que la molécula multiespecífica de unión a antígeno se dirige preferentemente a células…

Forrmulaciones estabilizadas que contienen anticuerpos anti-receptor de la interleucina 6 (IL-6R).

(30/10/2018). Solicitante/s: REGENERON PHARMACEUTICALS, INC.. Inventor/es: GRAHAM,KENNETH S, DIX,DANIEL B, KAMEN,DOUGLAS E, WALSH,SCOTT M.

Una formulación farmacéutica que comprende: (i) un anticuerpo humano que se une específicamente al receptor de interleucina 6 humano (hIL-6R), en el que el anticuerpo está en una concentración de 5 mg/ml a 200 mg/ml y comprende una región variable de la cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 18 y una región variable de la cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 26; (ii) histidina a una concentración de 10 mM a 25 mM; (iii) arginina a una concentración de 25 mM a 50 mM; (iv) sacarosa en una cantidad de 5 % a 10 % p/v; y (v) polisorbato en una cantidad de 0,1 % a 0,2 % p/v.

PDF original: ES-2688070_T3.pdf

Proteínas de unión a calicreína plasmática.

(30/10/2018) Un anticuerpo que se une a la forma activa de calicreína plasmática humana y no se une a precalicreína humana, y en el que el anticuerpo se selecciona del grupo que consiste en (i) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVS S y secuencia VL de DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (ii) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGS LRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGI TVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRTGIPRRDAFDIWG QGTMVTVSSASTKGPSVFPLAPSSKS y una secuencia VL de QDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPNLLIYKASTLESG VPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (iii) un anticuerpo que comprende una secuencia…

Región constante de anticuerpo modificado.

(29/10/2018). Solicitante/s: CHUGAI SEIYAKU KABUSHIKI KAISHA. Inventor/es: IGAWA,Tomoyuki , SHIRAIWA,HIROTAKE.

Una región constante de anticuerpo humano que comprende deleciones de ambas Gly en la posición 329 (posición 446 en el sistema de numeración EU) y Lys en la posición 330 (posición 447 en el sistema de numeración EI) en la secuencia de aminoácidos de SEQ ID NO: 1, en donde la amidación del aminoácido C-terminal de la región constante del anticuerpo IgG1 humana está suprimida.

PDF original: ES-2687808_T3.pdf

Formulaciones estabilizadas que contienen anticuerpos anti-receptor de interleucina 4 (IL-4R).

(29/10/2018) Una formulación farmacéutica líquida estable que comprende: (i) un anticuerpo humano que se une específicamente al receptor alfa de interleucina 4 humano (hIL-4Rα) a una concentración de hasta 200 mg/ml, en la que dicho anticuerpo humano que se une específicamente a hIL-4R consiste en dos cadenas pesadas y dos cadenas ligeras, comprendiendo cada cadena pesada una región variable de la cadena pesada (HCVR) que comprende la secuencia de aminoácidos de la SEQ ID NO: 1 y una región constante de la cadena pesada que comprende los dominios CH1, CH2 y CH3, y comprendiendo cada cadena ligera una región variable…

Anticuerpos útiles en la inmunización pasiva contra la gripe.

(26/10/2018). Solicitante/s: Trellis Bioscience, LLC. Inventor/es: KAUVAR, LAWRENCE, M., ELLSWORTH,STOTE, MCCUTCHEON,KRISTA MAUREEN, PARK,MINHA, USINGER,WILLIAM.

Un anticuerpo monoclonal humano, opcionalmente un anticuerpo biespecífico, o un fragmento inmunorreactivo del mismo, que comprende una cadena pesada que comprende CDR1 de la secuencia GGIIRKYAIN (SEQ ID NO: 77), CDR2 de la secuencia GGIIAIFNTANYAQKFQG (SEQ ID NO: 78) y CDR3 de la secuencia ARGMNYYSDYFDY (SEQ ID NO: 79) y una cadena ligera que comprende CDR1 de la secuencia RASQSVRSNNLA (SEQ ID NO: 80), una CDR2 de la secuencia GASSRAT (SEQ ID NO: 81) y una CDR3 de la secuencia QQYGSSPALT (SEQ ID NO: 82), en donde el anticuerpo o fragmento se une a la región tallo de la proteína HA0 y HA2 a partir de clados virales de influenza que incluyen al menos un clado de cada uno del Grupo 1 y Grupo 2 de influenza A.

PDF original: ES-2687706_T3.pdf

Composición farmacéutica líquida.

(26/10/2018). Solicitante/s: FRESENIUS KABI DEUTSCHLAND GMBH. Inventor/es: DEL RIO, ALESSANDRA, RINALDI,GIANLUCA, FRATARCANGELI,SILVIA.

Una composición farmacéutica acuosa que comprende: (a) adalimumab; (b) un agente de tamponamiento de acetato (o sistema de tampón de acetato); (c) un estabilizador de azúcar, en el que el estabilizador de azúcar es un disacárido no reductor seleccionado del grupo que incluye trehalosa y sacarosa (d) polisorbato 80; y en la que la composición: * tiene un pH entre 5.0 y 5.5; * es ya sea libre de arginina o comprende arginina en una concentración de a lo sumo 0.1 mM; * es ya sea libre de agentes de tamponamiento de fosfato o comprende un sistema de tampón de fosfato en una concentración de a lo sumo 0.1 mM; * es ya sea libre de aminoácidos o comprende uno o más aminoácidos en una concentración (colectiva) de a lo sumo 0.1 mM; y * es ya sea libre de surfactantes, con la excepción de polisorbato 80, o comprende uno o más de los surfactantes que excluyen polisorbato 80 en una concentración colectiva de a lo sumo 0.001 mM.

PDF original: ES-2687600_T3.pdf

VNAR CON ACTIVIDAD ANTI-ANGIOGÉNICA EN TUMORES SÓLIDOS DE ANIMALES DE COMPAÑÍA.

(25/10/2018). Solicitante/s: CENTRO DE INVESTIGACIÓN CIENTÍFICA Y DE EDUCACIÓN SUPERIOR DE ENSENADA, BAJA CALIFORNIA. Inventor/es: PANIAGUA SOLÍS,Jorge Fernando, LICEA NAVARRO,Alexei Fedorovish, ELOSUA PORTUGAL,Carolina, MILLÁN GÓMEZ,Dalia Vanessa, SÁNCHEZ CAMPOS,Liliana Noemi, DUEÑAS ESPINOZA,Salvador.

La presente invención se refiere a una novedosa proteína vNAR de SEQ ID No:1 capaz de inhibir la actividad del VEGF en mamíferos carnívoros de los géneros Canis y Felis, inhibiendo por consiguiente los tumores sólidos de ambos géneros.

Fijación como objetivo de ABCB5 para la terapia del cáncer.

(24/10/2018). Solicitante/s: THE BRIGHAM AND WOMEN'S HOSPITAL, INC.. Inventor/es: FRANK,MARKUS,H, SAYEGH,MOHAMED,H, FRANK,NATASHA Y.

Un anticuerpo monoclonal aislado que se une selectivamente a ABCB5, que comprende un dominio variable de la cadena pesada de inmunoglobulina que tiene una CDR1-H1, que comprende la secuencia de aminoácidos DYYMY, una CDR2-H2, que comprende la secuencia de aminoácidos TINDGGTHTY y una CDR3-H3, que comprende la secuencia de aminoácidos DDYYYGSHFDAMDY, y un dominio variable de la cadena ligera de inmunoglobulina que tiene una CDR1-L1, que comprende la secuencia de aminoácidos RASKSVSTSGYMH, una CDR2-L2, que comprende la secuencia de aminoácidos LVSNLES y una CDR3-L3, que comprende la secuencia de aminoácidos QHIRELTR.

PDF original: ES-2687270_T3.pdf

Proteínas específicas para BAFF y B7RP1 y usos de las mismas.

(24/10/2018) Proteína biespecífica, que comprende: (a) un polipéptido que comprende una secuencia de aminoácidos que tiene la siguiente fórmula: A-L1-P-L2- P, en la que A es una cadena pesada de inmunoglobulina de un anticuerpo de IgG, L1 es un primer ligador peptídico que está ausente o tiene de 3 a 40 aminoácidos de longitud, P es un péptido de unión a BAFF que tiene de 10 a 40 aminoácidos de longitud, y L2 es un segundo ligador peptídico que está ausente o tiene de 5 a 50 aminoácidos de longitud, y en la que la cadena pesada de inmunoglobulina de (a) y la cadena ligera de inmunoglobulina de (b) forman un anticuerpo de IgG, que comprende dos moléculas del polipéptido de (a) y dos moléculas de la cadena ligera de (b), que puede unirse a…

Anticuerpos estables y solubles que inhiben el TNF.

(24/10/2018). Solicitante/s: ESBATech, an Alcon Biomedical Research Unit LLC. Inventor/es: GUNDE,TEA, URECH,DAVID, BORRAS,LEONARDO.

Un inmunoenlazador que se une específicamente al TNFα humano, comprendiendo el inmunoenlazador: (i) una secuencia marco variable de la cadena pesada humana y secuencias de CDR H1, CDR H2 y CDR H3 procedentes de un inmunoenlazador de conejo, en la que el marco de región variable de la cadena pesada humana tiene al menos un 90% de identidad con la SEQ ID NO: 1; y (ii) una secuencia marco variable de la cadena ligera humana y secuencias de CDR L1, CDR L2 y CDR L3 procedentes de un inmunoenlazador de conejo, en la que la secuencia marco de la región variable de la cadena ligera humana tiene al menos un 85% de identidad con la SEQ ID NO: 2.

PDF original: ES-2687259_T3.pdf

Anticuerpo estable de unión a antígenos múltiples.

(24/10/2018) Una molécula de anticuerpo de unión a antígenos múltiples que comprende: a) dos dominios variables de cadena pesada, uno con especificidad para el antígeno A (VH-A) y uno con especificidad para el antígeno B (VH-B), y b) dos dominios variables de cadena ligera, uno con especificidad para el antígeno A (VL-A) y uno con especificidad para el antígeno B (VL-B), en donde el anticuerpo de unión a antígenos múltiples carece de dominios constantes, los dos dominios variables de cadena pesada comprenden: una Serina en la posición AHo 12, una Serina o Treonina en la posición AHo 103, y una Serina o Treonina en la posición AHo 144; y en donde los dos dominios variables de cadena ligera comprenden una Arginina en la posición AHo 50, en donde VH-A está unido a VL-B por…

Tetrahidrofolatos en combinación con inhibidores de EGFR.

(24/10/2018). Solicitante/s: ISOFOL MEDICAL AB. Inventor/es: GUSTAVSSON,BENGT, CARLSSON,BJÖRN.

Una composición farmacéutica que comprende como componentes: a. metilen-tetrahidrofolato; y b. cetuximab; para su uso en el tratamiento del cáncer, en la que dicha composición es para la administración en aislamiento de 5- fluorouracilo y en aislamiento de análogos, profármacos y/o metabolitos de 5-fluorouracilo.

PDF original: ES-2687293_T3.pdf

Inhibidores de factor XII para el tratamiento de trastornos inflamatorios neurológicos.

(23/10/2018). Solicitante/s: CSL BEHRING GMBH. Inventor/es: NOLTE,MARC, KLEINSCHNITZ,CHRISTOPH, MEUTH,SVEN, GOEBEL,KERSTIN, MCKENZIE,BRENT.

Inhibidor de factor XII para su uso en la prevención y/o el tratamiento y/o la mejora de una enfermedad inflamatoria neurológica, en el que el inhibidor de FXII comprende (i) la secuencia de polipéptidos de infestina-5 4 no mutante (SEQ ID NO: 2), o una variante de la misma, en la que la variante comprende (a) los aminoácidos 2-13 del extremo N de SEQ ID NO: 2; y al menos una y hasta cinco mutaciones de aminoácido fuera de dichos aminoácidos de extremo N que dan como resultado diferencias de la secuencia de infestina-4 no mutante; y/o (b) seis restos de cisteína conservados; y homología de al menos 70 % con la secuencia de infestina-4 no mutante; o (ii) un anticuerpo anti-FXII o fragmento de unión al antígeno del mismo, en el que el anticuerpo se une a FXII e inhibe su actividad y/o activación.

PDF original: ES-2687018_T3.pdf

Composiciones estabilizadas de anticuerpos.

(23/10/2018). Solicitante/s: NOVALIQ GMBH. Inventor/es: SCHERER, DIETER, GÜNTHER,Bernhard, PETTIGREW,ANTHONY, GRAF,GESCHE.

Una composición que comprende un polipéptido o proteína de unión al antígeno seleccionado de entre un anticuerpo monoclonal, un anticuerpo policlonal, un fragmento de anticuerpo, una proteína de fusión que comprende un fragmento de anticuerpo, un conjugado anticuerpo-fármaco y una cualquiera de sus combinaciones y un vehículo líquido que consiste en un alcano semifluorado de fórmula RFRH en donde RF es un segmento de hidrocarburo lineal perfluorado con 4 a 12 átomos de carbono, y en donde RH es un grupo alquilo lineal con 4 a 8 átomos de carbono; en donde el polipéptido o proteína de unión al antígeno se incorpora en la composición como para formar una dispersión o suspensión y en donde la composición opcionalmente comprende un líquido orgánico no fluorado, en donde la composición conserva al menos 85% de su actividad de unión al antígeno inicial durante el almacenaje de 6 meses a una temperatura entre la T.A. y 40ºC.

PDF original: ES-2687094_T3.pdf

Miembros de la familia TNF modificados dirigidos.

(19/10/2018). Solicitante/s: VIB VZW. Inventor/es: UZE, GILLES, TAVERNIER,JAN, PEELMAN,FRANK, BULTINCK,JENNYFER.

Una composición que comprende una proteína de fusión, en la que la proteína de fusión es una cadena simple que comprende: (i) un TNF humano modificado, que comprende tres copias de una cadena de TNF, en el que el TNF modificado tiene afinidad reducida hacia su receptor en comparación con el TNF de tipo silvestre; (ii) una secuencia enlazadora; y (iii) un resto de direccionamiento simple, en el que dicha secuencia enlazadora une las copias de TNF al resto de direccionamiento, y en la que la composición solo muestra actividad biológica significativa hacia células que son dianas del resto de direccionamiento.

PDF original: ES-2686668_T3.pdf

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(19/10/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Anticuerpo, o fragmentos de unión a antígeno, divalentes, del mismo, apto(s) para unirse a cMet, caracterizado(s) por que el anticuerpo comprende una cadena pesada que comprende CDR-H1, CDR-H2 y CDR- H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 7, 8 y 9; y una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 15, 16 y 17.

PDF original: ES-2686693_T3.pdf

Anticuerpos anti-CD33 y uso de los mismos para tratar cáncer.

(18/10/2018). Solicitante/s: SEATTLE GENETICS, INC. Inventor/es: JEFFREY,SCOTT, SUSSMAN,DJANGO, RYAN,MAUREEN, BURKE,PATRICK, SUTHERLAND,MAY KUNG.

Un anticuerpo aislado que se une específicamente a la proteína CD33 humana, en donde el anticuerpo comprende tres regiones determinantes de complementariedad de cadena pesada (CDR): CDR1 de cadena pesada que consiste en SEQ ID NO: 19, CDR2 de cadena pesada que consiste en SEQ ID NO: 20 y CDR3 de cadena pesada que consiste en SEQ ID NO: 21; y tres CDR de cadena ligera: CDR1 de cadena ligera que consiste en SEQ ID NO: 22, CDR2 de cadena ligera que consiste en SEQ ID NO: 23, y CDR3 de cadena ligera que consiste en SEQ ID NO: 24.

PDF original: ES-2686618_T3.pdf

Moléculas de unión a antígeno biespecíficas.

(17/10/2018) Una molécula de unión a antígeno biespecífica que comprende un primer fragmento Fab que se une específicamente a un primer antígeno, un segundo fragmento Fab que se une específicamente a un segundo antígeno y un dominio Fc compuesto de una primera y una segunda subunidad que pueden crear una asociación estable; en la que a) la molécula de unión a antígeno biespecífica proporciona unión monovalente al primer y/o al segundo antígeno, b) (i) el primer fragmento Fab se fusiona en su extremo C con el extremo N del segundo fragmento Fab, que a su vez se fusiona en su extremo C con el extremo N de la primera subunidad del dominio Fc, o (ii) el segundo fragmento Fab se fusiona en su extremo C con el extremo N del primer fragmento Fab, que a su vez se fusiona en su extremo C con el extremo N de la primera subunidad del dominio Fc, c) en el…

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(17/10/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Procedimiento para seleccionar un anticuerpo anti-c-Met o fragmentos de unión a antígeno divalentes del mismo apto(s) para inhibir la activación dependiente de ligando e independiente de ligando de c-Met, comprendiendo dicho procedimiento: i) cribar los anticuerpos generados y seleccionar los anticuerpos que pueden unirse específicamente a c-Met; ii) evaluar in vitro los anticuerpos seleccionados en la etapa i) para la inhibición de la proliferación celular de BxPC3, que comprende las etapas de: a) poner en contacto dichos anticuerpos seleccionados en la etapa i) con las células BxPC3; b) medir la incorporación de [3H]timidina en las células de la etapa a); y c) seleccionar los anticuerpos que conducen a una reducción de la incorporación de [3H]timidina de por lo menos 50%; y iii) analizar los anticuerpos seleccionados de la etapa ii) y seleccionar los anticuerpos que pueden inhibir la dimerización de c-Met.

PDF original: ES-2686335_T3.pdf

Inmunoterapia con células alogénicas redireccionadas.

(17/10/2018). Solicitante/s: YEDA RESEARCH AND DEVELOPMENT CO. LTD.. Inventor/es: ESHHAR, ZELIG, WAKS, TOVA, MARCUS,ASSAF.

Una cantidad efectiva de células T alogénicas que expresan un receptor quimérico dirigido al tumor no restringido por el MHC para uso en el tratamiento de cáncer en un paciente que ha sido sometido a linfodepleción parcial, en donde dicha linfodepleción parcial se da en un grado suficiente para retrasar la reacción del huésped frente al injerto durante un período suficiente para permitir que dicha cantidad efectiva de células T alogénicas ataque al tumor al que están dirigidas, pero en un grado insuficiente como para requerir el rescate del sistema inmune del huésped mediante trasplante de médula ósea.

PDF original: ES-2686424_T3.pdf

Nuevo método de preparación de antibióticos y sistema de plataforma basado en el mismo.

(17/10/2018) Un método de preparación de antibióticos, que comprende las siguientes etapas: determinar dianas seleccionadas de células procariotas, células eucariotas y virus con membranas de bicapa fosfolipídica como estructura básica de su membrana celular o envoltura; diseñar una estructura molecular de dicho antibiótico nuevo de acuerdo con la siguiente fórmula general:**Fórmula** en la que R es la región de reconocimiento, que reconoce específicamente dichas dianas o se combina con dichas dianas y F es la región efectora, que produce efectos farmacéuticos en dichas dianas, causando dichos efectos farmacéuticos la muerte; establecer una biblioteca de estructura molecular de la región de reconocimiento, que comprende preparar de manera artificial sustancias artificiales que reconocen específicamente dichas dianas así como…

Suministro de fármaco a los segmentos anterior y posterior del ojo usando gotas oftálmicas.

(16/10/2018). Solicitante/s: Rekik, Raouf. Inventor/es: REKIK,RAOUF.

Un kit que comprende o consiste en: a) ramipril y apraclonidina, o b) ramipril y brimonidina, o c) ramipril, neosinefrina, y timolol, en el que apraclonidina, brimonidina, neosinefrina, y timolol se pueden administrar simultáneamente o antes que ramipril.

PDF original: ES-2686173_T3.pdf

Tratamiento del dolor.

(15/10/2018). Solicitante/s: THE UNIVERSITY OF MELBOURNE. Inventor/es: COOK,ANDREW DAVID, HAMILTON,JOHN ALLAN.

Un antagonista de GM-CSF para su uso en el tratamiento del dolor en un sujeto, en el que dicho antagonista es un anticuerpo específico para GM-CSF o un anticuerpo específico para el receptor de GM-CSF, y en el que dicho dolor es dolor de cáncer óseo o dolor postquirúrgico.

PDF original: ES-2685895_T3.pdf

Agentes terapéuticos para enfermedades que implican neovascularización coroidea.

(15/10/2018). Ver ilustración. Solicitante/s: KEIO UNIVERSITY. Inventor/es: ISHIDA,SUSUMU.

Una composición farmacéutica que comprende un inhibidor de IL-6 como principio activo para su uso en prevenir y/o tratar una enfermedad que implica neovascularización coroidea, en la que el inhibidor de IL-6 es un anticuerpo que reconoce una IL-6, en la que la enfermedad que implica neovascularización coroidea es degeneración macular asociada a la edad, neovascularización coroidea miópica o neovascularización coroidea idiopática.

PDF original: ES-2685915_T3.pdf

Antagonista de VLA-1 para su utilización en el tratamiento de un accidente cerebrovascular.

(11/10/2018). Solicitante/s: Biogen MA Inc. Inventor/es: RELTON,JANE,K, GARDNER,HUMPHREY.

Antagonista de VLA-1 para su utilización en la prevención de un accidente cerebrovascular en un sujeto, en el que el sujeto ha experimentado un ataque isquémico transitorio (AIT), en el que el antagonista de VLA-1 es un anticuerpo anti-VLA-1 o fragmento de unión a antígeno del mismo.

PDF original: ES-2685802_T3.pdf

1 · · 3 · 5 · 10 · 19 · 37 · ››