104 Inventos, patentes y modelos industriales publicados el Viernes 26 de Octubre de 2018. (Página 3)

Celda para extracción electrolítica de metal.

Sección de la CIP Química y metalurgia

(26/10/2018). Solicitante/s: INDUSTRIE DE NORA S.P.A. Inventor/es: FAITA, GIUSEPPE, IACOPETTI,LUCIANO, FIORUCCI,ALESSANDRO. Clasificación: C25C7/02, C25C1/12, C25C7/06.

Celda elemental de un electrolizador para extracción electrolítica de metal, que comprende: - un ánodo con una superficie catalítica hacia la reacción de desprendimiento del oxígeno; - un cátodo adecuado para la deposición de metal desde un baño electrolítico dispuesto paralelo a dicho ánodo; - una pantalla porosa eléctricamente conductora interpuesta entre dicho ánodo y dicho cátodo; - una barra de suspensión anódica eléctricamente conductora, integral con el ánodo y conectada eléctricamente a la misma; - un dispositivo adecuado para la detección directa o indirecta de la corriente eléctrica que fluye a través de la barra de suspensión anódica; - una barra colectora anódica, eléctricamente conductiva y conectada eléctricamente a la barra de suspensión anódica.

PDF original: ES-2687602_T3.pdf

Método mejorado para la producción de metales.

Sección de la CIP Química y metalurgia

(26/10/2018). Solicitante/s: UNIVERSITY OF BRADFORD. Inventor/es: KUMARI,JEYA, PATEL,RAJ. Clasificación: C22B34/12, C22B5/04, C22B34/00.

Un método para la producción de un metal, el método comprende las etapas de: (a) mezclar un óxido del metal en un receptáculo con un agente reductor que comprende un metal del Grupo II o un hidruro del mismo en presencia de agua y/o un disolvente orgánico; (b) calentar la mezcla de un óxido del metal y un agente reductor; (c) lixiviar el material resultante con agua; y (d) lavar el material lixiviado con un ácido acuoso diluido.

PDF original: ES-2687658_T3.pdf

BIORREACTOR PARA LA MULTIPLICACIÓN DE LEVADURAS Y BACTERIAS LÁCTICAS.

(26/10/2018) 1. Biorreactor para la multiplicación de levaduras y bacterias lácticas, caracterizado porque está constituido a partir de un tanque , con sus correspondientes entrada y salida de producto a tratar, en cuyo seno se establece un eje vertical, rematado en unas aletas de agitación , eje que está asociado a una transmisión , controlada por un motor eléctrico , gobernado a su vez por un autómata que se establece en un cuadro de control , habiéndose previsto que en el seno de dicho tanque se establezcan una serie de difusores , conectados a un circuito de aire a presión, cuyo compresor está controlado por el autómata del cuadro de control , circuito en el que se interconecta un sistema de filtrado y esterilización del aire, con la particularidad de que incorpora un sistema de control de temperatura…

Válvula activable eléctricamente, en particular válvula de hidrocéfalo programable.

Sección de la CIP Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: CHRISTOPH MIETHKE GMBH & CO. KG. Inventor/es: MIETHKE, CHRISTOPH. Clasificación: A61M27/00.

Válvula de hidrocéfalo implantable con una activación eléctrica, con un control-EDV , que está en conexión operativa con al menos un medidor de presión, con preferencia en conexión operativa con un detector de la posición, y los valores de medición de la presión y los valores de medición de la inclinación con una previsión, para activar la válvula en caso de desviación esencial, en la que a través de la válvula conduce un canal de circulación para el licor y en el que las instalaciones de cierre de la válvula están dispuestas en el canal de circulación, caracterizada por que la instalación de activación para la válvula está constituida por una mecánica de palanca (2; 2a, 2b) y un accionamiento , en la que al menos un alojamiento de palanca (2c) se forma por una membrana, que encapsula al menos un accionamiento frente al licor.

PDF original: ES-2687707_T3.pdf

Arilsulfatasa A recombinante para reducir los niveles de galatosil sulfátidos en un sujeto.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(26/10/2018). Solicitante/s: Shire Pharmaceuticals Ireland Limited. Inventor/es: FOGH, JENS, ANDERSSON, CLAES, WEIGELT,CECILIA, HYDÉN,PIA, MÔLLER,CHRISTER. Clasificación: A61P25/00, C12N9/16, A61K38/00, A61K38/46.

Una formulación de arilsulfatasa A recombinante que comprende una cantidad eficaz de una glicoforma de arilsulfatasa A recombinante, que comprende una cantidad de manosa-6-fosfato expuesta que permite la endocitosis eficiente de la arilsulfatasa recombinante A in vivo a través de la ruta de la manosa-6-fosfato para su uso en la reducción de los niveles de galactosil sulfátido dentro de las células dentro del sistema nervioso central en un sujeto que padece y/o se le ha diagnosticado leucodistrofia metacromática, en la que la formulación no comprende ninguno de los siguientes: a) un vehículo para la administración de arilsulfatasa A recombinante en el sistema nervioso central, b) un componente capaz de causar la apertura o la interrupción de la barrera hematoencefálica, y c) una célula intacta, en la que la formulación es adecuada para administración sistémica.

PDF original: ES-2687671_T3.pdf

Un dispositivo de cocina inalámbrico operado sobre un fogón de calentamiento por inducción.

(26/10/2018) Un dispositivo apropiado para ser operado de forma inalámbrica en un fogón de calentamiento por inducción que tiene una o más de una bobina de inducción , que comprende una base de propiedades ferromagnéticas, que permite que el dispositivo sea calentado desde el fondo con la energía magnética transferida por la bobina de inducción , una unidad de control que tiene un microcontrolador que proporciona el control de los parámetros de operación como la temperatura, la velocidad del motor y la comunicación con el fogón y los medios de monitorización y comunicación como la interfaz de usuario, la pantalla, el RFID, y una bobina receptora que recibe parcialmente la potencia generada por la bobina de inducción , que proporciona la energía requerida para operar la unidad de control , - la bobina…

Prueba de equipos de comunicaciones.

Sección de la CIP Electricidad

(26/10/2018). Solicitante/s: TELEFONAKTIEBOLAGET LM ERICSSON (PUBL). Inventor/es: GROSSO,RENATO. Clasificación: H04L12/26.

Un método de prueba de un equipo de comunicaciones , que comprende: proporcionar al equipo de comunicaciones una carga de tráfico de prueba que varía con el tiempo a un nivel diferente de carga de tráfico de prueba, y medir uno o más parámetros que caracterizan al equipo de comunicaciones al manejar una transición de la carga de tráfico de prueba al nivel diferente, dicho método se caracteriza por que el equipo de comunicaciones es operable en uno de una pluralidad de modos de gestión de potencia , y proporcionar la carga de tráfico de prueba comprende proporcionar la carga de tráfico de prueba que varía con el tiempo, y la transición de la carga de tráfico de prueba al nivel diferente desencadena un cambio a uno diferente de los modos de gestión de potencia , y medir uno o más parámetros comprende medir uno o más parámetros que caracterizan al equipo de comunicaciones al manejar una transición al modo de gestión de potencia diferente.

PDF original: ES-2687709_T3.pdf

Dispositivos electrocrómicos de contacto.

(26/10/2018) Un procedimiento para producir un dispositivo electrocrómico, que comprende los pasos de: proporcionar una estructura electrocrómica en capas, que tiene una primera hoja de sustrato, una segunda hoja de sustrato, una primera capa conductora de electrones que cubre al menos parcialmente la mencionada primera hoja de sustrato, una segunda capa conductora de electrones que cubre al menos parcialmente la mencionada segunda hoja de sustrato, una capa electrocrómica que cubre al menos la mencionada primera capa conductora de electrones, una capa de contra electrones que cubre al menos parcialmente la mencionada capa conductora de electrones, y una capa de electrolito laminada entre y que cubre al menos parcialmente la primera capa electrocrómica y la mencionada capa de contra electrones; la mencionada estructura…

Dispositivo de sujeción.

(26/10/2018) Dispositivo de sujeción para sujetar una pieza de trabajo o una herramienta o un portaherramientas en una parte de máquina de una máquina herramienta, con una varilla tensora desplazable axialmente , un conjunto de sujeción que puede moverse a través de la varilla tensora entre una posición de sujeción y una posición de liberación, una disposición de resorte asociada a la varilla tensora para generar la fuerza tensora o de retracción del conjunto de sujeción y una unidad de liberación , mediante la cual puede moverse el conjunto de sujeción a través de la varilla tensora en contra de la fuerza de la disposición de resorte a la posición de liberación, comprendiendo la disposición de resorte al menos una unidad de resorte con varios elementos de resorte flexibles dispuestos entre…

Composiciones y métodos de formulación para fórmulas enterales que contengan ácido siálico.

Sección de la CIP Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: MJN U.S. Holdings, LLC. Inventor/es: MCMAHON,ROBERT,J, LOCNISKAR,MARY,FRANCES, RUMSEY,STEVEN,CHARLES, ANTHONY,JOSHUA,C, WANTANAGORN,RATCHAPONG. Clasificación: A23L1/305, A23L1/29, A23C9/13, A23C9/20, A23L33/10, A23L33/19, A23L33/18.

Una fórmula para lactantes nutricionalmente completa que comprende cGMP y un contenido total de proteína de entre 12 y 16 gramos/litro, de los cuales no más del 40% en peso es proporcionada por una cGMP que tiene una concentración potenciada de ácido siálico, en el que la concentración de ácido siálico del cGMP está por encima de aproximadamente 60 mg de ácido siálico por gramo.

PDF original: ES-2687648_T3.pdf

Estructura planiforme medicinal.

Sección de la CIP Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: PAUL HARTMANN AG. Inventor/es: MALOWANIEC, KRZYSZTOF-DANIEL. Clasificación: A61F13/00, A61M35/00, A61L15/44.

Apósito para heridas de varias capas que comprende una estructura planiforme medicinal, en el que la estructura planiforme medicinal es una capa de contacto con la herida y la capa de contacto con la herida comprende al menos una primera capa de un material fibroso con un primer lado superior dirigido hacia el cuerpo durante su uso y un segundo lado superior dirigido en sentido opuesto al cuerpo durante su uso y al menos una sustancia que fomenta la curación de heridas, que está presente en forma de partículas, estando unidas las partículas con el material fibroso y liberándose la sustancia que fomenta la curación de heridas en presencia de líquido acuoso, caracterizado porque sobre el segundo lado superior está dispuesta una capa absorbente, que comprende una espuma polimérica hidrófila.

PDF original: ES-2687649_T3.pdf

Dispositivo de inyección.

(26/10/2018) Un autoinyector que comprende: una carcasa adaptada para recibir un recipiente de fluido que tiene una boquilla de descarga y un pistón de dispensación que se puede mover en el recipiente de fluido para expulsar el contenido del recipiente de fluido fuera de la boquilla de descarga; un accionador adaptado durante la activación para actuar sobre el recipiente de fluido para hacerlo avanzar desde una posición retraída en la que la boquilla de descarga está contenida dentro de la carcasa a una posición extendida en la que la boquilla de descarga se extiende desde la carcasa y actúa sobre el pistón de dispensación para expulsar el contenido del recipiente de fluido fuera de la boquilla de descarga; un conector adaptado para recibir un vial que contiene fluido y conectarlo a la boquilla de…

Nuevas composiciones nutracéuticas y uso de las mismas.

Sección de la CIP Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: DSM IP ASSETS B.V.. Inventor/es: WEBER, PETER, RAEDERSTORFF, DANIEL, SCHWAGER,Joseph, SPITZER,VOLKER. Clasificación: A23G3/00, A23L1/30, A21D13/08, A23C9/13, A61K31/202, A23L1/302, A23G9/32, A61K31/355, A61K31/353, A23L2/52, A21D2/14, A21D2/36, A21D13/02, A23C9/152, A23G9/36, A23G3/36, A23L33/12, A23L33/105.

Composiciones que consisten en, como ingredientes activos, resveratrol y un ácido graso poliinsaturado.

PDF original: ES-2687657_T3.pdf

BANDEJA SOPORTE DE TIESTOS DE CULTIVO DE PLANTAS.

(26/10/2018) 1. Bandeja soporte de tiestos de cultivo de plantas, conformada por un cuerpo rígido que comprende un fondo y una pared perimetral que rodea a dicho fondo conformando un espacio superior adaptado para alojar a una pluralidad de tiestos de cultivo de plantas , caracterizado porque el cuerpo rígido es hueco y conforma una cámara interior extendida por el fondo y la pared perimetral , la cámara interior está en comunicación fluida con una primera abertura del cuerpo rígido y con unos orificios difusores practicados en el fondo y la pared perimetral , donde, la primera apertura está adaptada para acoplar unos medios generadores de un flujo de aire. 2. Bandeja según la reivindicación 1, en la que los medios generadores de flujo de aire acoplados a la primera abertura son un inyector…

Producto alimenticio adaptado y listo para consumir para pacientes con disfagia.

(26/10/2018) 1. Producto alimenticio adaptado y listo para consumir para pacientes con disfagia caracterizado porque comprende, al menos, una base de alimentos crudos de origen vegetal y un agente espesante, donde la base presenta textura estandarizada adaptada al nivel de disfagia del paciente. 2. Producto alimenticio adaptado y listo para consumir para pacientes con disfagia, según la reivindicación 1ª caracterizado porque la base de alimentos crudos de origen vegetal presenta textura estandarizada de puré líquido de consistencia suave y uniforme que no se puede comer con tenedor, textura estandarizada de puré líquido uniforme que solo se puede comer con cuchara y/o textura estandarizada de puré espeso moldeable que no requiere masticación. 3. Producto alimenticio adaptado y listo para consumir para pacientes con disfagia,…

Procedimiento para hacer funcionar una instalación de energía eólica e instalación de energía eólica.

(26/10/2018) Procedimiento para hacer funcionar una instalación de energía eólica con una góndola de la máquina dispuesta de forma giratoria sobre una torre y un rotor con tres álabes , de los que al menos dos son basculables en torno a un eje longitudinal del álabe, en donde la instalación de energía eólica es llevada a una posición de detención tras una orden de parada, caracterizado por que para alcanzar la posición de parada, la góndola de la máquina es girada en una posición azimutal transversalmente a la dirección del viento, un álabe es llevado a una zona de una posición de funcionamiento o es mantenido en una zona de una posición de funcionamiento que corresponde, en particular, en esencia a un ajuste del ángulo del álabe en una zona de carga parcial por debajo de una zona de carga total de la instalación…

Bicicleta de pedaleo asistido y método para controlar la bicicleta de pedaleo asistido.

(26/10/2018) Bicicleta de pedaleo asistido comprendiendo: una primera rueda (5') y una segunda rueda (5''), al menos un freno mecánico aplicado a una de la primera rueda (5') y la segunda rueda (5'') y un mando de frenado para accionar dicho freno mecánico; un conjunto de pedaleo desacoplado mecánicamente de dichas primera rueda (5') y segunda rueda (5''), mediante el que un usuario puede suministrar una energía de pedaleo (Wped), un motor eléctrico acoplado mecánicamente al menos a una de dichas primera rueda (5') y segunda rueda (5'') que puede absorber una energía del motor (Wmot), un dispositivo generador adaptado para generar una energía eléctrica de un dispositivo generador (Wgen) a partir de dicha energía de pedaleo (Wped), dispuesto en una relación de intercambio de energía con el conjunto…

Guía de fresado y sistema de preparación para el recorte de quilla.

Sección de la CIP Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: Centinel Spine Schweiz GmbH. Inventor/es: GERBER, DAVID, BERTAGNOLI,RUDOLPH, MURREY,DANIEL, FURDA,JOHN P, REICHEN,MARC. Clasificación: A61F2/30, A61B17/00, A61B17/16, A61F2/44, A61B17/17.

Un sistema de instrumentos para preparar un espacio intervertebral para recibir un implante, que comprende: un implante de prueba de un tamaño correspondiente a un implante real para el espacio intervertebral; una guía de fresado montada en dicho implante de prueba ; una herramienta de corte , caracterizado en que dicha guía de fresado incluye cámaras de guía longitudinales superior e inferior que están ahusadas desde un extremo delantero hasta un extremo posterior; y donde la herramienta de corte está configurada para ser recibida en dichas cámaras de guía para formar recortes en las vértebras superior e inferior adyacentes, incluyendo dicha herramienta de corte un miembro de soporte que se acopla a dichos extremos posteriores y forma un eje de pivote con la herramienta de corte en dicha cámara de guía cónica.

PDF original: ES-2687619_T3.pdf

Antagonistas de progesterona.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: Evestra, Inc. Inventor/es: NICKISCH, KLAUS, NARKUNAN,KESAVARAM, SANTHAMMA,BINDU, DEBNATH,BAISHAKHI. Clasificación: C07J41/00, A61K31/58, C07J1/00, C07J21/00, A61K31/567, C07J71/00, C07J43/00, C07J51/00, A61P5/36.

Un compuesto que tiene la estructura:**Fórmula** en donde R7 es (E)-CH≥CH-CF3, -CH2-CF≥CF2 o -CF2-CH≥CH2.

PDF original: ES-2687686_T3.pdf

Composiciones de péptido-2 similar a glucagón y métodos para producir y usar los mismos.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: Amunix Operating Inc. Inventor/es: SCHELLENBERGER, VOLKER, STEMMER,WILLEM P, WANG,CHIA-WEI, SILVERMAN,JOSHUA, SPINK,BENJAMIN, GEETHING,NATHAN. Clasificación: C07K14/605, A61K38/26.

Una composición para su uso en el tratamiento de la enteritis en un sujeto mamífero logrando un efecto intestinotrófico, comprendiendo la composición una proteína de fusión que comprende: (i) una secuencia de proteína-2 similar a glucagón (GLP-2) que consiste en la secuencia: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD y (ii) un polipéptido recombinante extendido (XTEN), en donde el XTEN es la secuencia AE864 de la tabla 4; en donde dicha composición muestra un efecto intestinotrófico cuando se administra al sujeto con enteritis que es al menos un 100% o al menos un 120% o al menos un 150% o al menos un 200% del efecto intestinotrófico comparado con el GLP-2 correspondiente no unido a XTEN tras la administración de dicho GLP-2 correspondiente a un sujeto comparable usando una dosis comparable.

PDF original: ES-2687651_T3.pdf

Cargas tratadas, composiciones que las contienen y artículos preparados a partir de ellas.

Sección de la CIP Química y metalurgia

(26/10/2018). Solicitante/s: PPG INDUSTRIES OHIO, INC.. Inventor/es: KOLLAH, RAPHAEL, O., OKEL,TIMOTHY,A, MARTIN,JUSTIN J. Clasificación: C09C1/30, C09C1/40.

Un proceso para producir una carga tratada, que comprende: (a) tratar una suspensión que comprende una carga no tratada, en donde dicha carga no tratada no ha sido secada previamente, con una composición de tratamiento que comprende un organosilano halo-funcional de fórmula general (I): R1SiX3 (I) en la que R1 es hidrocarburo organofuncional que comprende de 1 a 36 átomos de carbono, en donde el grupo funcional del hidrocarburo organofuncional es halógeno; X es independientemente alcoxi que comprende de 1 a 36 átomos de carbono; para producir una suspensión de carga tratada, y (b) secar dicha suspensión de carga tratada para producir una carga tratada, en donde dicha carga tratada se escoge entre silicato de aluminio, gel de sílice, sílice coloidal, sílice precipitada y mezclas de las mismas.

PDF original: ES-2687668_T3.pdf

Lámpara con LEDs y lente cilíndrica.

(26/10/2018) Lámpara, que comprende al menos un módulo con una pluralidad de LEDs distribuidos sobre una superficie modular , en la que en una dirección longitudinal (L) del módulo están dispuestos varios LEDs en una serie (R), y en la que en una dirección transversal (W) del módulo , perpendicular a la dirección longitudinal (L), están dispuestas varias de las series (R) adyacentes entre sí, y en la que la lámpara de LED comprende una óptica para la concentración de la luz emitida por los LEDs, en la que la óptica comprende al menos una primera lente cilíndrica que se extiende en dirección longitudinal, en la que la luz de al menos algunos de los LEDs de una primera de las series se concentra por medio de la primera lente cilíndrica en una línea sobre una superficie de destino, en la que la óptica comprende…

Método para protección contra enfermedad causada por patógenos secundarios.

Sección de la CIP Necesidades corrientes de la vida

(26/10/2018). Solicitante/s: INTERVET INTERNATIONAL B.V. Inventor/es: LAKSHMANAN,NALLAKANNU P, WASMOEN,TERRI LEE, DESHPANDE,MURALIDHAR S, JAYAPPA,HUCHAPPA GOWDA. Clasificación: A61K39/145.

Una vacuna que consiste en un virus de la gripe canina inactivado y, opcionalmente, un adyuvante para su uso en la proteccion de un canido contra Streptococcus equi.

PDF original: ES-2687702_T3.pdf

Cuerpo estructural para eje, elemento macho y elemento hembra.

(26/10/2018) Una estructura de eje para ser instalada en un eje capaz de realizar una transmisión de potencia, comprendiendo la estructura de eje : un componente macho metálico que tiene una pluralidad de acanaladuras machos (21d) formadas en una parte periférica exterior (21c) del mismo; un componente hembra metálico que tiene una pluralidad de acanaladuras hembras (22b) formadas en una parte periférica interior (22a) del mismo, la parte periférica interior (22a) configurada para permitir que la parte periférica exterior (21c) del componente macho se acople en su interior de modo que el componente macho y el componente hembra puedan encajar de forma deslizante, cada uno con respecto al otro en una dirección axial conformando así dicha estructura de eje ; y un elemento cilíndricamente conformado que tiene una…

Método para detectar partículas exopoliméricas transparentes en una muestra de agua.

Secciones de la CIP Física Química y metalurgia

(26/10/2018). Solicitante/s: KEMIRA OYJ. Inventor/es: HESAMPOUR,MEHRDAD, SAARI,EIJA, KARISALMI,KAISA, VIRKKI,HELI, NIEMELÄ,MIIA, KORTE,EIJA. Clasificación: G01N21/64, G01N21/77, C02F1/00, C02F1/44, G01N31/22, G01N15/06, G01N33/18.

Método para detectar partículas exopoliméricas transparentes en una muestra de agua, comprendiendo el método - obtener una muestra de agua, - introducir un reactivo fluorocromático en la muestra de agua, siendo el reactivo fluorocromático específico para grupos de hidróxido vecinales de partículas exopoliméricas transparentes, por lo que la señal de fluorescencia del reactivo cambia cuando entra en contacto con partículas exopoliméricas transparentes, - detectar la señal de fluorescencia de la muestra de agua y determinar el nivel de partículas exopoliméricas transparentes de la muestra.

PDF original: ES-2687710_T3.pdf

Sistema y método de acceso múltiple por división de frecuencia ortogonal híbrido.

(26/10/2018) Una unidad de transmisión/recepción inalámbrica (WTRU) configurada para realizar comunicaciones de acceso múltiple por división de frecuencia ortogonal (OFDMA) que comprende: un receptor configurado para recibir símbolos OFDMA, donde los símbolos OFDMA incluyen datos de entrada multiusuario expandidos a una primera pluralidad de subportadoras asignadas y datos de entrada no expandidos mapeados a una segunda pluralidad de subportadoras asignadas; en donde los datos de entrada multiusuario son para una pluralidad de usuarios y se expanden utilizando una multiplexación por división de frecuencia ortogonal (OFDM) de expansión utilizando diferentes factores de expansión en el dominio del tiempo, en el dominio de la frecuencia, o en ambos; en donde cada uno de los diferentes factores de expansión de la OFDM de expansión…

Bomba de aceite de caudal variable que comprende un sistema de regulación de la presión de aceite en función de la temperatura.

(26/10/2018) Bomba de aceite de caudal variable que comprende un sistema de regulación de la presión de aceite en función de la temperatura, comprendiendo la bomba: - un cárter de bomba, - un estátor que está montado móvil dentro del cárter , - un rotor que está montado a rotación dentro del estátor , alrededor de un eje de giro fijo con respecto al cárter , y el cual soporta paletas aptas para desplazarse radialmente con respecto al eje del rotor, - un sistema de regulación de la presión de impulsión de la bomba que está alojado dentro de una cámara de regulación de presión conformada en el cárter y que actúa sobre el estátor para desplazarlo y modificar la posición del eje de giro del rotor con respecto al estátor, en función de la presión de salida del aceite, - un circuito de regulación de…

Derivados heterocíclicos sustituidos con N-(hetero)arilo útiles para el tratamiento de enfermedades o afecciones relacionadas con el sistema nervioso central.

(26/10/2018) Un compuesto de acuerdo con la fórmula I, **Fórmula** donde: A se selecciona entre fenilo y heteroarilo; B se selecciona entre fenilo y heteroarilo; L es un enlazador seleccionado entre alquileno y O; R1 se selecciona entre H, alquilo, alcoxi, S-alquilo, S(O)qalquilo, COR5, CONR5R6, COOR5, CH2OH, OH, F y Cl; R2 se selecciona entre NR7R8, CR11R12NR7R8, CONR7R8, (CR11R12)2NR7R8 y (CR11R12)3NR7R8, en donde R1 es alquilo, alcoxi, CH2OH, COR5, CONR5R6 o COOR5 cuando R2 es NR7R8; R3 se selecciona entre H, alquilo, alcoxi, NR7R8, CH2OH, OH, F y Cl; o R2 y R3 se toman junto con los átomos de carbono a los que están unidos para formar un heterociclilo o un heteroarilo, donde el heterociclilo o el heteroarilo contienen al menos un miembro en el anillo seleccionado entre N y NR13; con la condición de que cuando…

Procedimiento para la producción de productos semiacabados de fibras compuestas.

(26/10/2018) Procedimiento para la producción de productos semiacabados de fibras compuestas con los pasos: a) producción de cintas laminares con los pasos a1) puesta a disposición de un material laminar ; a2) corte del material laminar para la generación de las cintas laminares ; a3) estiramiento de las cintas laminares con una carga de tensión definida y/o una carga de temperatura definida. b) Puesta a disposición de fibras de refuerzo ; c) la disposición de cintas laminares y fibras de refuerzo , de modo que las fibras de refuerzo son nidireccionales y las cintas laminares estabilizan a las fibras de refuerzo en su posición en el producto semiacabado de fibras compuestas , configurándose el producto semiacabado de fibras compuestas como tejido con las fibras de refuerzo como hilos de…

Máquina de soldadura a tope con tubo de plástico, elemento de calentamiento para esta, así como método para fabricar una placa de calentamiento.

Secciones de la CIP Técnicas industriales diversas y transportes Electricidad

(26/10/2018). Solicitante/s: WIDOS Wilhelm Dommer Söhne GmbH. Inventor/es: SCHMITT, MICHAEL, DOMMER,MARTIN. Clasificación: B29L23/00, B29C65/78, B29C65/20, H05B3/30, B29C65/30.

Máquina de soldadura a tope con tubo de plástico con al menos un elemento de calentamiento, que presenta una placa de calentamiento , en la que está integrada al menos una fuente eléctrica de calor , caracterizada por el hecho de que la placa de calentamiento presenta una estructura de espuma metálica (S), en la que está incorporada con conducción del calor la al menos una fuente eléctrica de calor.

PDF original: ES-2687719_T3.pdf

Conjunto de cordón para elevar un aparato de rescate.

(26/10/2018) Conjunto de cordón para elevar un aparato de rescate, en particular una camilla de rescate , que comprende un engranaje de elevación con medios de sujeción a fijar en diferentes puntos de sujeción del aparato de rescate, y un conjunto de cuerda para conectar el engranaje de elevación con un dispositivo de elevación, en el que dicho conjunto de cuerda comprende un conjunto de secciones de cuerda a conectar en serie entre sí, cada sección de cuerda con una longitud fija y un primer extremo que es conectable al dispositivo de elevación y un segundo extremo opuesto conectable al primer extremo de cualquier otra sección de cuerda o al engranaje de elevación , y cada sección de cuerda que comprende al menos dos series de cuerdas guiadas en paralelo dentro de la respectiva sección de cuerda entre su primer extremo…

Cabeza de tobera para la aplicación de un agente aislante.

(26/10/2018) Cabeza de tobera para la emisión de un chorro de rociado de un agente de aplicación, en particular de un agente aislante, en la que a) un flujo volumétrico determinado del agente de aplicación se aplica mediante el chorro de rociado , b) el chorro de rociado discurre sustancialmente plano en un plano de chorro, y c) el chorro de rociado presenta en el plano de chorro una determinada anchura de chorro (SB), que depende del flujo volumétrico del agente de aplicación, que comprende d) dos placas exteriores , y e) una placa central , que está dispuesta entre las dos placas exteriores y presenta, en el lado de rociado, un borde frontal con un contorno predeterminado, en la que f) la placa central presenta, en ambos lados, unas puntas exteriores , que sobresalen en la dirección de rociado, y …