Anticuerpos anti-CD3 y métodos de uso de los mismos.

Anticuerpo monoclonal frente a CD3 completamente humano aislado o fragmento del mismo, que comprende una secuencia de aminoácidos de cadena pesada que comprende tres regiones determinantes de complementariedad

(CDR) y una secuencia de aminoácidos de cadena ligera que comprende tres CDR, en el que las tres CDR de cadena pesada y las tres CDR de cadena ligera se seleccionan de:

a. una CDR1 de cadena pesada variable (CDR1 de VH) que comprende la secuencia de aminoácidos GYGMH (SEQ ID NO: 27), una CDR2 de cadena pesada variable (CDR2 de VH) que comprende la secuencia de aminoácidos VIWYDGSKKYYVDSVKG (SEQ ID NO: 28), una CDR3 de cadena pesada variable (CDR3 de VH) que comprende la secuencia de aminoácidos QMGYWHFDL (SEQ ID NO: 29), una CDR1 de cadena ligera variable (CDR1 de VL) que comprende la secuencia de aminoácidos RASQSVSSYLA (SEQ ID NO: 30), una CDR2 de cadena ligera variable (CDR2 de VL) que comprende la secuencia de aminoácidos DASNRAT (SEQ ID NO: 31) y una CDR3 de cadena ligera variable (CDR3 de VL) que comprende la secuencia de aminoácidos QQRSNWPPLT (SEQ ID NO: 32);

b. una CDR1 de VH que comprende la secuencia de aminoácidos SYGMH (SEQ ID NO: 33), una CDR2 de VH que comprende la secuencia de aminoácidos IIWYDGSKKNYADSVKG (SEQ ID NO: 34), una CDR3 de VH que comprende la secuencia de aminoácidos GTGYNWFDP (SEQ ID NO: 35), una CDR1 de VL que comprende la secuencia de aminoácidos (SEQ ID NO: 36), RASQGISSALA (SEQ ID NO: 39) o WASQGISSYLA (SEQ ID NO: 43), una CDR2 de VL que comprende la secuencia de aminoácidos GASSRAT (SEQ ID NO: 37), YASSLQS (SEQ ID NO: 40) o DASSLGS (SEQ ID NO: 42) y una CDR3 de VL que comprende la secuencia de aminoácidos QQYGSSPIT (SEQ ID NO: 38) o QQYYSTLT (SEQ ID NO: 41); y

c. una CDR1 de VH que comprende la secuencia de aminoácidos SYGMH (SEQ ID NO: 33); una CDR2 de VH que comprende la secuencia de aminoácidos AIWYNGRKQDYADSVKG (SEQ ID NO: 44); y una CDR3 de VH que comprende la secuencia de aminoácidos GTGYNWFDP (SEQ ID NO: 35); una CDR1 de VL que comprende la secuencia de aminoácidos RASQSVSSYLA (SEQ ID NO: 30) o RASQGISSALA (SEQ ID NO: 39); una CDR2 de VL que comprende la secuencia de aminoácidos DASNRAT (SEQ ID NO: 31) o DASSLES (SEQ ID NO: 46); y una CDR3 de VL que comprende la secuencia de aminoácidos QQRSNWPWT (SEQ ID NO: 45) o QQFNSYPIT (SEQ ID NO: 47)

en el que dicho anticuerpo contiene al menos una primera mutación en la cadena pesada en la posición 234 y una segunda mutación en la posición 235, y en el que dicha primera mutación da como resultado un residuo de alanina en la posición 234 y dicha segunda mutación da como resultado un residuo de ácido glutámico en la posición 235.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2005/019922.

Solicitante: NOVIMMUNE SA.

Nacionalidad solicitante: Suiza.

Dirección: 14 ch. Des Aulx, Plan-Les-Ouates 1228 Geneva SUIZA.

Inventor/es: KOSCO-VILBOIS, MARIE, LEGER,OLIVIER, MACH,BERNARD, DEAN,YANN, FISCHER,NICOLAS, ELSON,Greg Christopher Andrew.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/28 (contra receptores, antígenos celulares de superficie o determinantes celulares de superficie)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/47 (de mamíferos)

PDF original: ES-2526343_T3.pdf

 

google+ twitter facebookPin it
Ilustración 1 de Anticuerpos anti-CD3 y métodos de uso de los mismos.
Ilustración 2 de Anticuerpos anti-CD3 y métodos de uso de los mismos.
Ilustración 3 de Anticuerpos anti-CD3 y métodos de uso de los mismos.
Ilustración 4 de Anticuerpos anti-CD3 y métodos de uso de los mismos.
Ilustración 5 de Anticuerpos anti-CD3 y métodos de uso de los mismos.
Ilustración 6 de Anticuerpos anti-CD3 y métodos de uso de los mismos.
Anticuerpos anti-CD3 y métodos de uso de los mismos.

Fragmento de la descripción:

Anticuerpos anti-CD3 y métodos de uso de los mismos CAMPO DE LA INVENCIÓN

Esta invención se refiere en general a anticuerpos anti-CD3 completamente humanos así como a métodos para el uso de los mismos.

ANTECEDENTES DE LA INVENCIÓN

El sistema inmunitario del cuerpo sirve como defensa frente a una variedad de estados, incluyendo, por ejemplo, lesión, infección y neoplasia, y está mediado por dos sistemas separados pero interrelacionados, los sistemas inmunitarios celular y humoral. En términos generales, el sistema humoral está mediado por productos solubles, denominados anticuerpos o inmunoglobulinas, que tienen la capacidad para combinarse con y neutralizar productos reconocidos por el sistema como foráneos para el cuerpo. En cambio, el sistema inmunitario celular implica la movilización de determinadas células, denominadas células T que sirven para una variedad de papeles terapéuticos.

El sistema inmunitario de tanto seres humanos como animales incluye dos clases principales de linfocitos: las células derivadas del timo (células T) y las células derivadas de la médula ósea (células B). Las células T maduras surgen del timo y circulan entre los tejidos, los ganglios linfáticos y el torrente sanguíneo. Las células T presentan especificidad inmunológica y están implicadas directamente en respuestas inmunitarias mediadas por células (tales como rechazo de injerto). Las células T actúan contra o en respuesta a una variedad de estructuras foráneas (antígenos). En muchos casos estos antígenos foráneos se expresan sobre células huésped como resultado de infección. Sin embargo, los antígenos foráneos también pueden proceder del huésped habiéndose alterado por neoplasia o infección. Aunque las células T no secretan por sí mismas anticuerpos, se requieren habitualmente para la secreción de anticuerpos por la segunda clase de linfocitos, las células B.

Hay diversos subconjuntos de células T, que se definen generalmente por determinantes antigénicos que se encuentran en sus superficies celulares, así como actividad funcional y reconocimiento de antígenos foráneos. Algunos subconjuntos de células T, tales como células CD8+, son células citolíticas/supresoras que desempeñan una función de regulación en el sistema inmunitario, mientras que otros, tales como células CD4+, sirven para promover respuestas inflamatorias y humorales.

Pueden estimularse linfocitos T periféricos humanos para que experimenten mitosis mediante una variedad de agentes incluyendo antígenos foráneos, anticuerpos monoclonales y lectinas tales como fitohemaglutinina y concanavalina A. Aunque la activación se produce presumiblemente mediante unión de los mitógenos a sitios específicos en membranas celulares, la naturaleza de estos receptores, y su mecanismo de activación, no está completamente aclarado. La inducción de proliferación es sólo una indicación de activación de células T. Otras indicaciones de activación, definidas como alteraciones en el estado basal o de reposo de la célula, incluyen aumento de la producción de linfocinas y actividad celular citotóxica.

La activación de células T es un fenómeno complejo que depende de la participación de una variedad de moléculas de superficie celular expresadas en la población de células T que responde. Por ejemplo, el receptor de células T específico de antígeno (TcR) está compuesto por un heterodímero unido por disulfuro, que contiene dos cadenas de glicoproteína de membrana integrales, distribuidas clonalmente, alfa y beta (a y |3), o gamma y delta (y y 6), no asociadas covalentemente con un complejo proteínas invariantes de bajo peso molecular, designado comúnmente como CD3 (denominado una vez T3).

Las cadenas alfa y beta de TcR determinan las especificidades de antígeno. Las estructuras de CD3 representan moléculas accesorias que son los elementos transducción de señales de activación iniciadas tras la unión del TcR alfa beta (TcR a(3) a su ligando. Hay tanto regiones constantes de las cadenas de glicoproteína de TcR como regiones variables (polimorfismos). Las regiones variables de TcR polimórficos definen subconjuntos de células T, con especificidades distintas. A diferencia de anticuerpos que reconocen fragmentos completos o más pequeños de proteínas foráneas como antígenos, el complejo de TcR interacciona con sólo péptidos pequeños del antígeno, que deben presentarse en el contexto de moléculas del complejo mayor de histocompatibilidad (CMH). Estas proteínas del CMH representan otro conjunto altamente polimórfico de moléculas dispersadas aleatoriamente por todas las especies. Por tanto, la activación requiere habitualmente la interacción tripartita del TcR y el antígeno peptídico foráneo unido a las proteínas del CMH principales.

SUMARIO DE LA INVENCIÓN

La presente invención proporciona anticuerpos monoclonales completamente humanos dirigidos específicamente contra CD3. Los anticuerpos de la invención comprenden las secuencias de CDR y mutaciones de cadenas pesadas definidas en la reivindicación 1. Los anticuerpos monoclonales a modo de ejemplo incluyen 28F11, 27H5, 23F1 y 15C3 descritos en el presente documento. Los anticuerpos se denominan respectivamente en el presente

documento anticuerpos frente a huCD3. El anticuerpo frente a huCD3 tiene una o más de las siguientes características: el anticuerpo se une a células positivas para CD3 (CD3+) pero no a células negativas para CD3 (CD3-); el anticuerpo frente a huCD3 induce modulación antigénica que implica alteración (por ejemplo, disminución) de la actividad o el nivel de expresión en la superficie celular de CD3 o el receptor de células T (TcR); el anticuerpo frente a huCD3 inhibe la unión del anticuerpo monoclonal murino anti-OKT3 humano a linfocitos T; o el anticuerpo frente a huCD3 se une a un epítopo de CD3 que incluye total o parcialmente la secuencia de aminoácidos EMGGITQTPYKVSISGT (SEQ ID NO: 21). Los anticuerpos frente a huCD3 de la invención compiten con el anticuerpo murino OKT3 anti-CD3 por la unión a CD3, y la exposición al anticuerpo frente a huCD3 elimina o enmascara CD3 y/o TcR sin afectar a la expresión en la superficie celular de CD2, CD4 o CD8. El enmascaramiento de CD3 y/o TcR da como resultado pérdida o reducción de activación de células T, que es deseable en enfermedades autoinmunitarias en las que se produce activación no controlada de células T. La regulación por disminución de CD3 da como resultado un efecto prolongado de activación de células T reducida, por ejemplo, durante un periodo de al menos varios meses, en comparación con la supresión transitoria que se observa cuando se usa un agente inmunosupresor tradicional, por ejemplo, ciclosporina.

Modulación antigénica se refiere a la redistribución y eliminación del complejo CD3-receptor de células T sobre la superficie de una célula, por ejemplo, un linfocito. La disminución en el nivel de actividad o expresión en la superficie celular del TcR en la célula quiere decir que la cantidad o función del TcR se reduce. La modulación del nivel de actividad o expresión en la superficie celular de CD3 significa que la cantidad de CD3 en la superficie celular o la función de CD3 se altera, por ejemplo, se reduce. La cantidad de CD3 o el TcR expresado en la membrana plasmática de la célula se reduce, por ejemplo, mediante la internalización de CD3 o el TcR tras el contacto de la célula con el anticuerpo frente a huCD3. Alternativamente, tras el contacto de una célula con el anticuerpo frente a huCD3, se enmascara CD3 o el TcR.

La inhibición de la unión del anticuerpo monoclonal murino anti-OKT3 humano a un linfocito T se define como una disminución en la capacidad del anticuerpo murino frente a OKT3 para formar un complejo con CD3 en la superficie... [Seguir leyendo]

 


Reivindicaciones:

1. Anticuerpo monoclonal frente a CD3 completamente humano aislado o fragmento del mismo, que comprende una secuencia de aminoácidos de cadena pesada que comprende tres regiones determinantes

de complementariedad (CDR) y una secuencia de aminoácidos de cadena ligera que comprende tres CDR,

en el que las tres CDR de cadena pesada y las tres CDR de cadena ligera se seleccionan de:

a. una CDR1 de cadena pesada variable (CDR1 de VH) que comprende la secuencia de aminoácidos GYGMH (SEQ ID NO: 27), una CDR2 de cadena pesada variable (CDR2 de VH) que comprende la

secuencia de aminoácidos VIWYDGSKKYYVDSVKG (SEQ ID NO: 28), una CDR3 de cadena pesada

variable (CDR3 de VH) que comprende la secuencia de aminoácidos QMGYWHFDL (SEQ ID NO: 29), una CDR1 de cadena ligera variable (CDR1 de VL) que comprende la secuencia de aminoácidos RASQSVSSYLA (SEQ ID NO: 3), una CDR2 de cadena ligera variable (CDR2 de VL) que comprende la secuencia de aminoácidos DASNRAT (SEQ ID NO: 31) y una CDR3 de cadena ligera variable (CDR3 de 15 VL) que comprende la secuencia de aminoácidos QQRSNWPPLT (SEQ ID NO: 32);

b. una CDR1 de VH que comprende la secuencia de aminoácidos SYGMH (SEQ ID NO: 33), una CDR2 de VH que comprende la secuencia de aminoácidos IIWYDGSKKNYADSVKG (SEQ ID NO: 34), una CDR3 de VH que comprende la secuencia de aminoácidos GTGYNWFDP (SEQ ID NO: 35), una CDR1 de VL que

comprende la secuencia de aminoácidos (SEQ ID NO: 36), RASQGISSALA (SEQ ID NO: 39) o

WASQGISSYLA (SEQ ID NO: 43), una CDR2 de VL que comprende la secuencia de aminoácidos GASSRAT (SEQ ID NO: 37), YASSLQS (SEQ ID NO: 4) o DASSLGS (SEQ ID NO: 42) y una CDR3 de VL que comprende la secuencia de aminoácidos QQYGSSPIT (SEQ ID NO: 38) o QQYYSTLT (SEQ ID NO: 41); y 25

c. una CDR1 de VH que comprende la secuencia de aminoácidos SYGMH (SEQ ID NO: 33); una CDR2 de VH que comprende la secuencia de aminoácidos AIWYNGRKQDYADSVKG (SEQ ID NO: 44); y una CDR3 de VH que comprende la secuencia de aminoácidos GTGYNWFDP (SEQ ID NO: 35); una CDR1 de VL que comprende la secuencia de aminoácidos RASQSVSSYLA (SEQ ID NO: 3) o RASQGISSALA (SEQ ID NO:

39); una CDR2 de VL que comprende la secuencia de aminoácidos DASNRAT (SEQ ID NO: 31) o

DASSLES (SEQ ID NO: 46); y una CDR3 de VL que comprende la secuencia de aminoácidos QQRSNWPWT (SEQ ID NO: 45) o QQFNSYPIT (SEQ ID NO: 47)

en el que dicho anticuerpo contiene al menos una primera mutación en la cadena pesada en la posición 234 35 y una segunda mutación en la posición 235, y en el que dicha primera mutación da como resultado un

residuo de alanina en la posición 234 y dicha segunda mutación da como resultado un residuo de ácido glutámico en la posición 235.

2. Anticuerpo según la reivindicación 1 o fragmento del mismo, que inhibe la unión del anticuerpo monoclonal

murino anti-OKT3 humano a un linfocito T.

3. Anticuerpo según la reivindicación 1 o fragmento del mismo, que se une a un epítopo que incluye total o parcialmente la secuencia de aminoácidos EMGGITQTPYKVSISGT (SEQ ID NO: 67).

4. Anticuerpo según la reivindicación 1 o fragmento del mismo, que comprende una CDR1 de VH que

comprende la secuencia de aminoácidos de GYGMH (SEQ ID NO: 27); una CDR2 de VH que comprende la secuencia de aminoácidos de VIWYDGSKKYYVDSVKG (SEQ ID NO: 28); una CDR3 de VH que comprende la secuencia de aminoácidos de QMGYWHFDL (SEQ ID NO: 29); una CDR1 de VL que comprende la secuencia de aminoácidos de RASQSVSSYLA (SEQ ID NO: 3); una CDR2 de VL que 5 comprende la secuencia de aminoácidos de DASNRAT (SEQ ID NO: 31); y una CDR3 de VL que

comprende la secuencia de aminoácidos de QQRSNWPPLT (SEQ ID NO: 32), y en el que el anticuerpo comprende además una cadena pesada variable que comprende la secuencia de aminoácidos de SEQ ID NO: 2 y una cadena ligera variable que comprende la secuencia de aminoácidos de SEQ ID NO: 4.

5. Anticuerpo según la reivindicación 1 o fragmento del mismo, que comprende una cadena pesada con tres

CDR, que comprenden una CDR1 de VH que comprende la secuencia de aminoácidos de GYGMH (SEQ ID NO: 27); una CDR2 de VH que comprende la secuencia de aminoácidos de VIWYDGSKKYYVDSVKG (SEQ ID NO: 28); una CDR3 de VH que comprende la secuencia de aminoácidos de QMGYWHFDL (SEQ ID NO: 29) y una cadena ligera con tres CDR, que comprenden una CDR1 de VL que comprende la 6 secuencia de aminoácidos de RASQSVSSYLA (SEQ ID NO: 3); una CDR2 de VL que comprende la

secuencia de aminoácidos de DASNRAT (SEQ ID NO: 31); y una CDR3 de VL que comprende la secuencia de aminoácidos de QQRSNWPPLT (SEQ ID NO: 32), y en el que el anticuerpo comprende además una cadena pesada variable que comprende la secuencia de aminoácidos de SEQ ID NO: 6 y una cadena ligera variable que comprende la secuencia de aminoácidos de SEQ ID NO: 8.

6. Anticuerpo según la reivindicación 1 o fragmento del mismo, que tiene una cadena pesada con tres CDR,

que comprenden una CDR1 de VH que comprende la secuencia de aminoácidos SYGMH (SEQ ID NO: 33); una CDR2 de VH que comprende la secuencia de aminoácidos de IIWYDGSKKNYADSVKG (SEQ ID NO: 34); una CDR3 de VH que comprende la secuencia de aminoácidos de GTGYNWFDP (SEQ ID NO: 35); y una cadena ligera con tres CDR que comprenden una CDR1 de VL que comprende la secuencia de aminoácidos de RASQSVSSSYLA (SEQ ID NO: 36); RASQGISSALA (SEQ ID NO: 39); o WASQGISSYLA (SEQ ID NO: 43); una CDR2 de VL que comprende la secuencia de aminoácidos de GASSRAT (SEQ ID NO: 37), YASSLQS (SEQ ID NO: 4) o DASSLGS (SEQ ID NO: 42); y una CDR3 de VL que comprende la secuencia de aminoácidos de QQYGSSPIT (SEQ ID NO: 38) o QQYYSTLT (SEQ ID NO: 41), y en el que el anticuerpo comprende además una cadena pesada variable que comprende la secuencia de aminoácidos

de SEQ ID NO: 1 y una cadena ligera variable que comprende la secuencia de aminoácidos de SEQ ID NO: 16, 17, 18, 19 ó 2.

7.

Anticuerpo según la reivindicación 1 o fragmento del mismo, que tiene una cadena pesada con tres CDR, que comprenden una CDR1 de VH que comprende la secuencia de aminoácidos SYGMH (SEQ ID NO: 33);

una CDR2 de VH que comprende la secuencia de aminoácidos de AIWYNGRKQDYADSVKG (SEQ ID NO: 44); una CDR3 de VH que comprende la secuencia de aminoácidos de GTGYNWFDP (SEQ ID NO: 35); y una cadena ligera con tres CDR, que comprenden una CDR1 de VL que comprende la secuencia de aminoácidos de RASQSVSSYLA (SEQ ID NO: 3) o RASQGISSALA (SEQ ID NO: 39); una CDR2 de VL que comprende la secuencia de aminoácidos de DASNRAT (SEQ ID NO: 31) o DASSLES (SEQ ID NO:

46); y una CDR3 de VL que comprende la secuencia de aminoácidos de QQRSNWPWT (SEQ ID NO: 45) o QQFNSYPIT (SEQ ID NO: 47), y en el que dicho anticuerpo comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 22, y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 25 ó 26.

8.

Anticuerpo según la reivindicación 1 o fragmento del mismo, que comprende una región de entramado 2 (FWR2) que comprende la secuencia de aminoácidos WVRQAPGKGLEWV (SEQ ID NO: 73).

9.

Anticuerpo según la reivindicación 1 o fragmento del mismo, que comprende una región de entramado 3 (FRW3) que comprende la secuencia de aminoácidos RFTISRDNSKNTLYLQMNSLRAEDTAVYYCA (SEQ

ID NO: 74).

Anticuerpo según la reivindicación 1 o fragmento del mismo, que comprende una región variable ubicada C- terminal con respecto a la región CDR3, en el que dicha región variable comprende la secuencia de aminoácidos VTVSS (SEQ ID NO: 64) en una posición que es C-terminal con respecto a la región CDR3.

11.

Anticuerpo según la reivindicación 1 o fragmento del mismo, que comprende una región variable ubicada C-terminal con respecto a la región CDR3, en el que dicha región variable comprende la secuencia de aminoácidos GTLVTVSS (SEQ ID NO: 65) en una posición que es C-terminal con respecto a la región CDR3.

12.

Anticuerpo según la reivindicación 1 o fragmento del mismo, que comprende una región variable ubicada C-terminal con respecto a la región CDR3, en el que dicha región variable comprende la secuencia de aminoácidos WGRGTLVTVSS (SEQ ID NO: 66) en una posición que es C-terminal con respecto a la región CDR3.

13.

Composición farmacéutica que comprende un anticuerpo o fragmento del mismo según cualquiera de las reivindicaciones 1 a 12.

14.

Anticuerpo o fragmento del mismo según cualquier reivindicación anterior para su uso como medicamento.

Uso del anticuerpo o fragmento del mismo según cualquiera de las reivindicaciones 1 a 12 para la fabricación de un medicamento para el tratamiento o la prevención de un síntoma asociado con un trastorno relacionado con la inmunidad, o un síntoma relacionado con rechazo asociado con trasplante de órgano.

16.

Uso según la reivindicación 15, en el que al sujeto se le administra además un segundo agente.

17.

Uso según la reivindicación 15, en el que el trastorno relacionado con la inmunidad se selecciona de una enfermedad autoinmunitaria, un trastorno inflamatorio.

18.

Molécula de ácido nucleico aislada que codifica para un anticuerpo o fragmento del mismo según cualquiera de las reivindicaciones 1 a 12.

19.

Vector que comprende la molécula de ácido nucleico según la reivindicación 18.

2.

Célula huésped que comprende el vector según la reivindicación 19.

21. Método de producción del anticuerpo o fragmento del mismo según cualquiera de las reivindicaciones 1 a 12, que comprende las etapas de cultivar la célula huésped según la reivindicación 2 en condiciones adecuadas para la producción del anticuerpo.