CIP 2015 : C07K 14/52 : Citoquinas; Linfoquinas; Interferones.

CIP2015CC07C07KC07K 14/00C07K 14/52[2] › Citoquinas; Linfoquinas; Interferones.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C07 QUIMICA ORGANICA.

C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.

C07K 14/52 · · Citoquinas; Linfoquinas; Interferones.

CIP2015: Invenciones publicadas en esta sección.

Anticuerpos anti-IL-23p19 obtenidos por ingeniería genética.

(12/04/2019) Un anticuerpo o fragmento de unión a antígeno del mismo que se une a IL-23 humana en un epítopo que comprende los restos K20, T23, W26, S27, P30, E82, S95, L96, L97, P98, D99, P101, G103, Q104, H106 , A107 y L110 de la SEQ ID NO: 47; en el que dicho anticuerpo o fragmento de unión a antígeno comprende: (a) un dominio variable de cadena ligera, o fragmento de unión a antígeno del mismo, que comprende CDRL1, CDRL2 y CDRL3, en el que: CDRL1 comprende la secuencia de la SEQ ID NO: 36 o una variante de la misma; CDRL2 comprende la secuencia de la SEQ ID NO: 41 o una variante de la misma; y CDRL3 comprende la secuencia de la SEQ ID NO: 46 o una…

Vacunas contra el VPH.

(10/04/2019). Solicitante/s: VACCIBODY AS. Inventor/es: FREDRIKSEN,AGNETE BRUNSVIK, BREKKE,OLE HENRIK, AREFFARD,ALI, LINDEBERG,MONA MARI.

Una proteína homodimérica de dos cadenas de aminoácidos idénticas, comprendiendo cada cadena de aminoácidos un péptido señal, una unidad de direccionamiento, un motivo de dimerización, y una unidad antigénica, comprendiendo dicha unidad de direccionamiento una secuencia de aminoácidos que tiene al menos 80 % de identidad de secuencia respecto de la secuencia de aminoácidos 24-93 de SEQ ID NO:1, y una unidad antigénica que comprende una secuencia de aminoácidos que tiene al menos 80 % de identidad de secuencia respecto de la SEQ ID NO:22 (E6 de VPH16) y/o SEQ ID NO:24 (E6 de VPH18) y una secuencia de aminoácidos que tiene al menos 80 % de identidad de secuencia respecto de SEQ ID NO:23 (E7 de VPH16) y/o SEQ ID NO:25 (E7 de VPH18), y donde dichas secuencias de aminoácidos comprenden una o más mutaciones para inhibir las propiedades oncogénicas.

PDF original: ES-2730718_T3.pdf

Inmunoconjugados novedosos.

(03/04/2019). Solicitante/s: ROCHE GLYCART AG. Inventor/es: AST, OLIVER, DR., KLEIN, CHRISTIAN, DR., UMANA,PABLO, BRUENKER,PETER, MOESSNER,EKKEHARD, HOSSE,RALF, HOFER,THOMAS U.

Un inmunoconjugado que comprende (i) una molécula de inmunoglobulina que comprende una primera y una segunda molécula de Fab de unión a antígeno y un dominio Fc que consta de dos subunidades, y (ii) un resto efector, en el que no está presente más de un resto efector; y en el que dicha primera y dicha segunda molécula de Fab se dirigen al ACE y comprenden una secuencia de la región variable de la cadena pesada de la SEQ ID NO: 191, y una secuencia de la región variable de la cadena ligera de la SEQ ID NO: 189; y dicho resto efector es un polipéptido de interleucina-2 (IL-2) humana mutante que comprende las sustituciones de aminoácidos T3A, F42A, Y45A, L72G (numeración con relación a la secuencia de la IL-2 humana en la SEQ ID NO: 2); y dicho dominio Fc comprende las sustituciones de aminoácidos L234A, L235A y P329G (numeración de la UE) en cada una de sus subunidades.

PDF original: ES-2707297_T3.pdf

Constructos de proteínas homodiméricas.

(27/03/2019). Solicitante/s: VACCIBODY AS. Inventor/es: BOGEN,BJARNE, FREDRIKSEN,AGNETE BRUNSVIK, RUFFINI,PIER ADELCHI.

Una proteína homodimérica de dos cadenas idénticas de aminoácidos, cada cadena de aminoácidos comprende una unidad de marcaje que comprende una secuencia de aminoácidos que tiene al menos un 98 % de identidad con la secuencia de aminoácidos 5-70 de SEQ ID NO:1, y una unidad antigénica. La unidad de marcaje y la unidad antigénica se conectan a través de un motivo de dimerización.

PDF original: ES-2706058_T3.pdf

Ratones modificados genéticamente e injerto.

(19/02/2019). Solicitante/s: REGENERON PHARMACEUTICALS, INC.. Inventor/es: YANCOPOULOS, GEORGE, D., MURPHY, ANDREW, J., STEVENS,Sean, FLAVELL,RICHARD, EYNON,ELIZABETH, GALAN,JORGE, WILLINGER,TIM, MANZ,MARKUS G, RONGVAUX,ANTHONY.

Un raton Rag2-/-IL-2rγ-/- modificado geneticamente, que comprende una sustitucion de un gen de trombopoyetina (TPO) de raton con un gen de TPO humana en un locus del gen de TPO de raton, en donde el raton comprende celulas hematopoyeticas humanas y el raton esta infectado por un patogeno humano que no infecta ratones de tipo silvestre.

PDF original: ES-2700852_T3.pdf

Animales no humanos modificados genéticamente que expresan EPO humana.

(06/02/2019) Un roedor modificado geneticamente, que comprende: una secuencia de acido nucleico que codifica una proteina de eritropoyetina humana (hEPO), en donde el acido nucleico esta unido operativamente a un promotor del gen de la eritropoyetina (EPO) endogeno en el locus del gen de EPO de roedor, en donde la union operativa da como resultado una mutacion nula en el gen de EPO de roedor en el locus del gen EPO de roedor y en donde el roedor expresa proteinas humanas adicionales seleccionadas entre el grupo que consiste en: una proteina hM-CSF codificada por un acido nucleico bajo el control de un promotor de M-csf en donde el promotor de M-csf es un promotor de M-csf de roedor endogeno en el locus del gen de M-csf de roedor y en donde…

Tratamiento de dolencias asociadas a septicemia.

(30/10/2018). Ver ilustración. Solicitante/s: TLA Targeted Immunotherapies AB. Inventor/es: WINQVIST,OLA, COTTON,GRAHAM.

Un reactivo de union capaz de unirse especificamente al receptor de quimioquina CXCR1 para su uso en el tratamiento de la septicemia o del sindrome de insuficiencia respiratoria (RDS), en donde el reactivo de union esta inmovilizado sobre un soporte solido contenido en una columna de aferesis, a la cual se aplica sangre periferica procedente de un paciente eliminando por tanto las celulas que expresan CXCR1 de la sangre periferica del paciente.

PDF original: ES-2688081_T3.pdf

Proteína recombinante.

(01/10/2018). Solicitante/s: UBI Pharma Inc. Inventor/es: PENG,WEN-JIUN, YANG,SHU-PING, PENG,HUNG-CHIH, CHEN,YU-HUNG.

Una proteína recombinante, que comprende una eritropoyetina y un péptido altamente glicosilado localizado en el extremo terminal amino o en el extremo carboxiterminal de la eritropoyetina y en el que el péptido altamente glicosilado se define por la SEQ ID NO: 1 o 2 o una combinación de las mismas.

PDF original: ES-2683983_T3.pdf

Método novedoso para tratar el daño a la médula espinal utilizando el fragmento de hmgb1.

(11/04/2018). Solicitante/s: Genomix Co., Ltd. Inventor/es: TAMAI,KATSUTO, YAMAZAKI,TAKEHIKO, CUI,WENHAO.

Una composición farmacéutica para su uso en el tratamiento de daño a la médula espinal, la cual comprende un fragmento de péptido de HMGB1 seleccionado del grupo que consiste de: a) un fragmento de péptido que comprende al menos el fragmento de péptido de la SEC ID NO: 3 con el límite superior siendo el fragmento de péptido que consiste del péptido de la SEC ID NO: 4; b) un fragmento de péptido que comprende al menos el fragmento de péptido de la SEC ID NO: 4 con el límite superior siendo el fragmento de péptido que consiste del péptido de la SEC ID NO: 5; y c) un fragmento de péptido que comprende al menos el fragmento de péptido de la SEC ID NO: 3 con el límite superior siendo el fragmento de péptido que consiste del péptido de la SEC ID NO: 5.

PDF original: ES-2673861_T3.pdf

Proceso para la purificación del factor estimulador de colonias de granulocitos, G-CSF.

(28/02/2018). Solicitante/s: OCTAPHARMA AG. Inventor/es: WINGE, STEFAN, GILLJAM,GUSTAV, TIEMEYER,MAYA.

Un proceso de purificación del factor estimulador de colonias de granulocitos recombinante humano (rhG-CSF) en una secuencia de purificación empleando cromatografía, caracterizado porque - al menos una cromatografía se realiza usando resina Capto MMCTM, - rhG-CSF se une a la resina Capto MMCTM a un pH entre 4 y 6, y - el rhG-CSF se eluye a un pH entre 5,5 y 6,5 y en donde la elución se realiza con arginina que tiene una concentración en el rango de 0,1 M a 2,0 M, - opcionalmente en combinación con una etapa de cromatografía de afinidad por ligando que emplea un fragmento Fab derivado de levadura dirigido contra el rhG-CSF.

PDF original: ES-2670827_T3.pdf

Tratamiento de esclerosis múltiple.

(17/01/2018). Solicitante/s: TLA Targeted Immunotherapies AB. Inventor/es: WINQVIST,OLA, COTTON,GRAHAM.

Un reactivo de unión capaz de unirse específicamente al receptor de quimioquina CCR2 para su uso en el tratamiento de esclerosis múltiple, en donde el reactivo de unión está inmovilizado en un soporte sólido contenido dentro de una columna de aféresis, a la que se aplica sangre periférica de un paciente separando así las células que expresan CCR2 de la sangre periférica del paciente, en donde el reactivo de unión es la quimioquina MCP-1/CCL2.

PDF original: ES-2664836_T3.pdf

Conjugados que contienen secuencias procedentes de factor de crecimiento placentario y su uso como componentes de biomateriales y en medicina.

(20/12/2017). Solicitante/s: ECOLE POLYTECHNIQUE FEDERALE DE LAUSANNE (EPFL). Inventor/es: HUBBELL, JEFFREY, A., MARTINO,MIKAËL, BRIQUEZ,PRISCILLA SUHASNA MAITHILI.

Un vehículo de aporte biológico que comprende una fusión molecular de un péptido y un agente biológico que comprende un primer dominio de unión a heparina, en donde el péptido comprende un segundo dominio de unión a heparina que comprende un péptido que comprende una secuencia elegida del grupo que consiste en SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 60, SEQ ID NO: 62, y subsecuencias de SEQ ID NO: 4 que tienen un truncamiento de no más de 7 residuos en un extremo N y/o un extremo C de SEQ ID NO: 4, exhibiendo dicho péptido unión específica a fibrinógeno.

PDF original: ES-2663230_T3.pdf

CITOQUINAS PROINFLAMATORIAS COMO MARCADOR DIAGNÓSTICO EN EL SÍNDROME VESTIBULAR EPISÓDICO.

(07/12/2017). Solicitante/s: SERVICIO ANDALUZ DE SALUD. Inventor/es: LÓPEZ ESCAMEZ,Jose Antonio, REQUENA NAVARRO,María Teresa, ESPINOSA SÁNCHEZ,Juan Manuel, FREJO NAVARRO,Lidia.

Uso de las citoquinas proinflamatorias IL1ß, IL6, TNF¿ para la obtención de datos útiles para el diagnóstico y clasificación de una enfermedad que cursa con síndrome vestibular episódico, método de obtención de datos útiles para el diagnóstico y clasificación dicha enfermedad, kit o dispositivo y usos.

Acondicionamiento angiogénico para potenciar la reprogramación celular cardiaca de fibroblastos del miocardio infartado.

(04/10/2017). Solicitante/s: CORNELL UNIVERSITY . Inventor/es: CRYSTAL, RONALD, G., ROSENGART,TODD K, GERSCH,ROBERT, MATHISON,MEGUMI.

Combinación de vectores que comprende (a) un primer vector viral que codifica para una o más proteínas angiogénicas que inducen vascularización en el corazón del mamífero, y (b) un segundo vector viral que codifica para uno o más factores de transcripción de diferenciación cardiaca que inducen la producción de cardiomiocitos inducidos (iCM) en el corazón del mamífero para su uso en un método de tratamiento de arteriopatía coronaria en un mamífero, en la que el primer y segundo vector se administran al corazón del mamífero.

PDF original: ES-2651716_T3.pdf

Tratamiento de afecciones respiratorias.

(17/05/2017). Solicitante/s: TLA Targeted Immunotherapies AB. Inventor/es: WINQVIST,OLA, COTTON,GRAHAM.

Un reactivo de unión capaz de unirse específicamente al receptor de quimiocinas CCR2 para uso en el tratamiento de una afección respiratoria, en donde el reactivo de unión está inmovilizado en un soporte sólido contenido dentro de una columna de aféresis, a la que se aplica sangre periférica de un paciente retirando de este modo células que expresan el receptor de quimiocinas CCR2 de la sangre periférica del paciente.

PDF original: ES-2637390_T3.pdf

Polipéptidos de eritropoyetina de acción prolongada y usos de los mismos.

(03/05/2017). Solicitante/s: OPKO Biologics Ltd. Inventor/es: FARES,FUAD, FIMA,UDI EYAL.

Un polipéptido modificado por CTP que consiste en una eritropoyetina (EPO), y tres CTP, en el que dichos CTP son péptidos carboxi terminales de gonadotropina coriónica de la subunidad beta de gonadotropina coriónica humana, en el que el primer CTP está unido al extremo amino de dicha EPO, y el segundo y el tercer CTP están unidos al extremo carboxi de dicha EPO, en el que dichos CTP comprenden la secuencia aminoacídica SSSSKAPPPS, en el que dicha EPO carece de un péptido señal, y en el que la secuencia aminoacídica de dicho polipéptido modificado por CTP comprende la secuencia de aminoácidos 28-277 de SEQ ID NO: 3 o los aminoácidos 28-249 de la SEQ ID NO: 6.

PDF original: ES-2636668_T3.pdf

Péptidos y compuestos que se unen al receptor de trombopoyetina.

(05/04/2017). Solicitante/s: Janssen Pharmaceuticals, Inc. Inventor/es: MACDONALD,BRIAN R, WEIS,JEFFERY KENNETH, YURKOW,EDWARD JOHN.

Un compuesto que se une a un receptor de trombopoyetina (TPO), en el que dicho compuesto comprende (HIEGPTLRQ( 2-Nal)LAARX10)2KNH2, en el que X10 se selecciona del grupo que consiste en sarcosina o ß-alanina, en el que 2-Nal es ß-(2-naftilo)alanina, y en el que dicho compuesto se une covalentemente a un polímero hidrófilo.

PDF original: ES-2626107_T3.pdf

Supresión del cáncer.

(29/03/2017) Un polipéptido, para uso en la supresión o tratamiento del cáncer mediante la inhibición de la secreción autocrina de una célula cancerosa en un paciente, en el que el polipéptido comprende: (i) una proteasa no citotóxica, proteasa que es capaz de escindir una proteína SNARE expresada en dicha célula cancerosa; (ii) un Resto de Direccionamiento (TM) que es capaz de unirse a un Sitio de Unión en una célula cancerosa, Sitio de Unión que es capaz de experimentar endocitosis para ser incorporado en un endosoma en la célula cancerosa; y (iii) un dominio de translocación que es capaz de translocar la proteasa desde dentro de un endosoma, a través de la membrana endosomal y en el citosol de la célula cancerosa; en el que el polipéptido carece de la función de unión natural de un dominio Hcc de neurotoxina clostridial que permite a la…

Moléculas de ácidos nucleicos inmunoestimuladoras que comprenden motivos GTCGTT.

(08/02/2017). Solicitante/s: UNIVERSITY OF IOWA RESEARCH FOUNDATION. Inventor/es: WEINER,GEORGE, KLINMAN,DENNIS, KRIEG,ARTHUR.

Un oligonucleótido inmunoestimulador aislado que tiene 13-30 bases de longitud que comprende dos o tres motivos GTCGTT, en donde el oligonucleótido inmunoestimulador empieza con TC o TG en el extremo 5', en donde el oligonucleótido es sintético, monocatenario y comprende al menos una modificación forotioato en la cadena principal.

PDF original: ES-2624859_T3.pdf

Miembro de la familia de ligandos de TNF.

(25/01/2017). Solicitante/s: GLAXO GROUP LIMITED. Inventor/es: FARROW,STUART NEVILLE, KAPTEIN,ALLARD, KITSON,JEREMY DAVID ALISDAIR, WINDER,ALISON JANET.

Un anticuerpo que es específico para una proteína trimérica seleccionada del grupo que consiste en: a) una proteína trimérica que tiene la secuencia de aminoácidos SEQ ID NO: 1 y b) una proteína trimérica que tiene una secuencia de aminoácidos por lo menos idéntica en un 98% a la SEQ ID NO: 1 y capaz de unirse a las células B; para uso en el tratamiento de una enfermedad autoinmune, artritis reumatoide, inflamación o cáncer; en donde dicho anticuerpo es un antagonista de la unión de dicha proteína trimérica a su receptor en la línea celular RPMI 8866 del linfoma B.

PDF original: ES-2621858_T3.pdf

ADN de TSLP humano y polipéptidos.

(11/01/2017). Solicitante/s: IMMUNEX CORPORATION. Inventor/es: SIMS, JOHN, E., LYMAN,STEWART, MCKENNA,HILARY, ARMSTRONG,ALLISON.

Una molécula aislada de ácido nucleico que codifica a un polipéptido que estimula la proliferación de linfocitos, seleccionada del grupo que consiste de: (a) un polinucleótido que comprende la secuencia de la SEQ ID NO: 1; (b) un polinucleótido que codifica una secuencia de aminoácidos que comprende la secuencia de la SEQ ID NO: 2; (c) un polinucleótido aislado que consiste de la SEQ ID NO: 1; y (d) un polinucleótido que comprende una secuencia de nucleótidos que es al menos 90% idéntica a la SEQ ID NO: 1.

PDF original: ES-2288036_T5.pdf

PDF original: ES-2288036_T3.pdf

Péptidos VEGF quiméricos.

(04/01/2017). Solicitante/s: THE OHIO STATE UNIVERSITY RESEARCH FOUNDATION. Inventor/es: KAUMAYA,PRAVIN, COHN,DAVID.

Péptido quimérico que comprende: (a) al menos un epítopo de VEGF humano constituido por KCECRPKKDRARQENPCG; (b) un epítopo de células T colaboradoras seleccionado del grupo constituido por NSVDDALINSTIYSYFPSV (TT), PGINGKAIHLVNNQSSE (TT1), QYIKANSKFIGITEL (P2), FNNFTVSFWLRVPKVSASHLE (P30), LSEIKGVIVHRLEGV (MVF), FFLLTRILTIPQSLN (HBV) y TCGVGVRVRSRVNAANKKPE (CSP); y (c) un conector de 2 a 15 aminoácidos de longitud que une al menos un epítopo de VEGF al epítopo de células T colaboradoras, en el cual el conector está unido operativamente al C terminal de al menos un epítopo de VEGF y al N terminal del epítopo de células T colaboradoras.

PDF original: ES-2617062_T3.pdf

Anticuerpo monoclonal para la proteina de union a osteoprotegerina.

(07/12/2016). Solicitante/s: AMGEN INC.. Inventor/es: BOYLE, WILLIAM, J., DESHPANDE,RAJENDRA,V, HITZ,ANNA, SULLIVAN,John,K.

Un anticuerpo monoclonal o un dominio de unión a antígeno del mismo que se une a una porción de la secuencia de aminoácidos: GGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP (SEQ ID NO: 76) desde el resto de aminoácido 212 hasta el resto de aminoácido 250 de OPGbp (proteína de unión a osteoprotegerina) humana, en donde el anticuerpo o el dominio de unión a antígeno del mismo inhibe la formación o la activación de osteoclastos mediada por OPGbp humana.

PDF original: ES-2612124_T3.pdf

Diagnóstico y tratamiento de enfermedad inflamatoria del intestino y síndrome del intestino irritable.

(30/11/2016) Método para diagnosticar, supervisar la progresión de o supervisar el tratamiento de enfermedad inflamatoria del intestino, que comprende determinar los niveles de monocitos CD14+HLA-DRhi en una muestra obtenida de un sujeto, en donde: (i) niveles aumentados de monocitos CD14+HLA-DRhi en comparación con: (a) una muestra de control obtenida de un sujeto sano; o (b) una muestra de control obtenida de un sujeto enfermo; o (c) un valor umbral predeterminado calculado por análisis estadístico de niveles de monocitos CD14+HLADRhi obtenidos de pacientes enfermos y en comparación con niveles de monocitos CD14+HLA-DRhi obtenidos de sujetos sanos; indican la existencia de enfermedad inflamatoria…

Anticuerpos que se unen inmunoespecíficamente a BLyS.

(12/10/2016) Un anticuerpo humano o humanizado que neutraliza se une a la Proteína Estimuladora de Linfocitos B o un fragmento funcional del mismo, en el que dicho anticuerpo es (a) un anticuerpo humano o humanizado que se une a la Proteína Estimuladora de Linfocitos B, en el que el anticuerpo comprende los restos de aminoácidos 26-35, 50-66, 99-112, 163-173, 189-195 y 228-238 de la SEQ ID NO: 2; (b) un anticuerpo monoclonal humano o humanizado que inhibe competitivamente la unión del anticuerpo producido por la línea celular que tiene el Número de Depósito ATCC PTA-3239 a la Proteína Estimuladora de Linfocitos B; o (c) un anticuerpo monoclonal humano o humanizado que reduce la unión del anticuerpo producido por la línea celular que…

Anticuerpos que se unen inmunoespecíficamente a BLyS.

(28/09/2016) Un anticuerpo humano o humanizado que neutraliza se une a la Proteína Estimuladora de Linfocitos B o un fragmento funcional del mismo, en el que dicho anticuerpo es (a) un anticuerpo humano que se une a la Proteína Estimuladora de Linfocitos B en el que el anticuerpo comprende los restos de aminoácidos 26-35, 50-66, 99-112, 163-173, 189-195 y 228-238 de la SEQ ID NO: 327; (b) un anticuerpo monoclonal humano o humanizado que inhibe competitivamente la unión del anticuerpo producido por la línea celular que tiene el Número de Depósito ATCC PTA-3240 a la Proteína Estimuladora de Linfocitos B; o (c) un anticuerpo monoclonal humano o humanizado que reduce la unión del anticuerpo producido por la línea celular que tiene el…

Proteina de fusión OX40-inmunoglobulina trimérica y métodos de uso.

(24/08/2016). Solicitante/s: Providence Health & Services - Oregon. Inventor/es: WEINBERG,ANDREW,D, MORRIS,NICHOLAS P, PETERS,CARMEN.

Un polipéptido de fusión que comprende en una dirección N-terminal a C-terminal: un dominio de inmunoglobulina, donde el dominio de inmunoglobulina comprende un dominio Fc; un dominio de trimerización; y un dominio de unión al receptor; donde el dominio de unión al receptor es: (a) un dominio de unión al receptor OX-40L, que es capaz de unirse al receptor OX-40 y estimular al menos una actividad mediada por OX-40; y opcionalmente comprende una secuencia de polipéptidos al menos un 95% idéntica a la SEC. ID. N.º: 2 u opcionalmente comprende un dominio extracelular del ligando OX-40 (OX-40L); o (b) un anticuerpo anti-receptor OX-40, o un fragmento del mismo de unión a antígeno, que es capaz de estimular al menos una actividad mediada por OX-40, donde la actividad mediada por OX-40 es opcionalmente la proliferación de linfocitos T CD4+; y donde el polipéptido de fusión se autoconjuga con una proteína de fusión trimérica o hexamérica.

PDF original: ES-2605380_T3.pdf

Procedimiento de purificación de un factor proteico de crecimiento G-CSF.

(13/07/2016). Solicitante/s: OCTAPHARMA AG. Inventor/es: WINGE, STEFAN, GILLJAM,GUSTAV, TIEMEYER,MAYA.

Un procedimiento de purificación de G-CSF (Factor estimulante de colonias de granulocitos) en una secuencia de purificación que emplea cromatografía, caracterizado porque - al menos una cromatografía se lleva a cabo utilizando una resina multimodal que contiene un ligando ácido 2- (benzoilamino) butanoico cargado negativamente - el G-CSF se une a la resina multimodal a un pH entre 4 y 6,2, y - el G-CSF se eluye a un pH > 6,3 y en el que la elución se lleva a cabo con un agente de elución que comprende arginina a una concentración en el intervalo de 0,1 M a 2,0 M, - opcionalmente en combinación con una etapa de cromatografía de afinidad con un ligando que emplea un fragmento Fab derivado de levaduras dirigido hacia el G-CSF.

PDF original: ES-2596727_T3.pdf

Factor de transferencia a partir de huevos de ave.

(15/06/2016). Solicitante/s: 4LIFE RESEARCH LC. Inventor/es: HENNEN, WILLIAM J., LISONBEE,DAVID T.

Un método para obtener el factor de transferencia, que comprende: exponer de forma no invasiva un animal de fuente no mamífera a por lo menos un agente antigénico de un patógeno de mamífero que provocará que dicho animal de fuente no mamífera produzca una respuesta inmunitaria mediada por células T; permitir que dicho animal de fuente no mamífera produzca dicha respuesta inmunitaria mediada por células T para dicho por lo menos un agente antigénico; recolectar por lo menos un huevo de dicho animal de fuente no mamífera después de dicha respuesta inmunitaria mediada por células T, dicho por lo menos un huevo que incluye el factor de transferencia que transfiere inmunidad celular a un mamífero in vivo y que incluye moléculas del factor de transferencia que tienen pesos moleculares de 4,000 Da a 5,000 Da; y recolectar dichas moléculas de factores de transferencia de dicho por lo menos un huevo.

PDF original: ES-2592261_T3.pdf

Fusoquinas que implican citoquinas con afinidades de unión por el receptor fuertemente reducidas.

(25/05/2016). Solicitante/s: VIB VZW. Inventor/es: UZE, GILLES, TAVERNIER,JAN, BULTINCK,JENNYFER, GERLO,SARAH, PAUL,FRANCIANE, BORDAT,YANN.

Una composición que comprende una proteína de fusión que comprende al menos dos citoquinas, en la que las citoquinas son CCL20 e IL-1ß, y en la que al menos una citoquina comprende una mutación que reduce fuertemente la actividad de unión a su receptor, y al menos una citoquina es una citoquina natural que proporciona un direccionamiento específico de célula que restaura la actividad de la citoquina mutante en las células diana.

PDF original: ES-2657060_T3.pdf

Moduladores del receptor MRG.

(27/04/2016). Solicitante/s: Bayer Pharma Aktiengesellschaft. Inventor/es: GOLZ, STEFAN, MICUS,SINA.

Un procedimiento de cribado para un antagonista de un receptor Mrg que comprende las etapas de a. poner en contacto un compuesto de ensayo con un polipéptido receptor Mrg en presencia de un polipéptido CXCL14. b. detectar la unión de un polipéptido CXCL14 con dicho polipéptido receptor Mrg en presencia de dicho compuesto de ensayo, c. poner en contacto el CXCL14 con un polipéptido receptor Mrg en ausencia de dicho compuesto de ensayo, d. detectar la unión de un polipéptido CXCL14 con dicho polipéptido receptor Mrg en ausencia de dicho compuesto de ensayo.

PDF original: ES-2659184_T3.pdf

Tetrapéptidos derivados de quimiocinas humanas C-X-C útiles para el tratamiento de diversas afecciones de la piel.

(20/04/2016). Solicitante/s: HELIX BIOMEDIX INC. Inventor/es: ZHANG,Lijuan, CARMICHAEL,ROBIN.

Un tetrapéptido aislado que presenta actividad de reparación y regeneración de heridas que consiste en la secuencia peptídica (I o V)-X1-K-X2, donde X1 es E, Q o K, y X2 es M, F, I, W, V o L.

PDF original: ES-2631804_T3.pdf

1 · · 3 · 4 · ››

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015