Dirección de anticuerpos mediante un dominio de reconocimiento modular.

Un anticuerpo de longitud completa aislado que comprende al menos un dominio de reconocimiento modular (MRD),

en el que el MRD es de 2 a 60 aminoácidos y la diana del MRD es angiopoyetina-2 (Ang-2), en el que la diana del sitio de combinación de anticuerpo es un antígeno tumoral, y en el que el MRD está unido de forma funcional al extremo C-terminal de la cadena pesada del anticuerpo, el extremo N-terminal de la cadena pesada del anticuerpo, el extremo C-terminal de la cadena ligera del anticuerpo o el extremo N-terminal de la cadena ligera del anticuerpo y en el que el MRD comprende una secuencia seleccionada del grupo que consiste en:

MGAQTNFMPMDDLEQRLYEQFILQQGLE (SEQ ID NO:7),

MGAQTNFMPMDNDELLLYEQFILQQGLE (SEQ ID NO:8),

MGAQTNFMPMDATETRLYEQFILQQGLE (SEQ ID NO:9),

AQQEECEFAPWTCEHM (SEQ ID NO:21)

AQQEECELAPWTCEHM (SEQ ID NO:24),

AQQEECEFSPWTCEHM (SEQ ID NO:27),

AQQEECEFSPWTCEHMGSGSATGGSGSTASSGSGSATHQEECEFSPWTCEH MLE2xConFS (SEQ ID NO:29),

AQQEECELEPWTCEHM (SEQ ID NO:30),

MGAQTNFMPMDNDELLNYEQFILQQGLE (SEQ ID NO:11) y

PXDNDXLLNY (SEQ ID NO:12), en el que X se selecciona de uno de los 20 aminoácidos de origen natural.

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E14154498.

Solicitante: THE SCRIPPS RESEARCH INSTITUTE.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: Mail Drop TPC-8 10550 North Torrey Pines Road La Jolla, CA 92037 ESTADOS UNIDOS DE AMERICA.

Inventor/es: BARBAS III,CARLOS F.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • C07K14/00 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.
  • C07K16/28 C07K […] › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.
  • C07K16/32 C07K 16/00 […] › contra productos de traducción de oncogenes.
  • C07K7/08 C07K […] › C07K 7/00 Péptidos con 5 a 20 aminoácidos en una secuencia totalmente determinada; Sus derivados. › con 12 a 20 aminoácidos.

PDF original: ES-2689274_T3.pdf

 

  • Fb
  • Twitter
  • G+
  • 📞

Patentes similares o relacionadas:

Composiciones y procedimientos de transfección de polinucleótidos, del 12 de Diciembre de 2018, de WASHINGTON UNIVERSITY: Una composición farmacéutica que comprende un complejo péptido-polinucleótido, comprendiendo el complejo péptido-polinucleótido una relación molar de péptido:polinucleótido […]

Un péptido anfipático, del 7 de Diciembre de 2018, de THE QUEEN'S UNIVERSITY OF BELFAST: Un péptido que penetra en las células anfipáticas con menos de aproximadamente 50 residuos de aminoácidos que tiene al menos 6 residuos de arginina (R), […]

Péptidos que se unen específicamente al receptor de HGF (cMet) y usos de los mismos, del 30 de Noviembre de 2018, de DYAX CORP.: Polipéptido aislado que se une a cMet o un complejo que comprende cMet y HGF, en el que el polipéptido comprende la secuencia de aminoácidos expuesta como […]

Polipéptidos de enrollamiento al azar de prolina/alanina biosintéticos y sus usos, del 28 de Noviembre de 2018, de XL-protein GmbH: Conjugado de fármaco que comprende (i) un polipéptido de enrollamiento al azar biosintético o segmento de polipéptido que comprende una […]

Vacuna conjugada de péptido antigénico de WT1, del 7 de Noviembre de 2018, de Sumitomo Dainippon Pharma Co., Ltd: Un compuesto representado por la fórmula :**Fórmula** en donde Xa e Ya son cada uno un enlace sencillo, el péptido antigénico […]

Péptidos que penetran en las células para la administración intracelular de moléculas, del 30 de Octubre de 2018, de CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE: Un péptido que penetra en las células, caracterizado por que comprende una secuencia de aminoácidos X1X2X3WWX4X5WAX6X3X7X8X9X10X11X12WX13R […]

Proteínas específicas para BAFF y B7RP1 y usos de las mismas, del 24 de Octubre de 2018, de AMGEN INC.: Proteína biespecífica, que comprende: (a) un polipéptido que comprende una secuencia de aminoácidos que tiene la siguiente fórmula: A-L1-P-L2- P, en la que […]

PÉPTIDO ÚTIL EN LA INMUNOMODULACIÓN, del 2 de Febrero de 2012, de CURE TECH LTD. MOR-RESEARCH APPLICATIONS LTD: Un péptido que comprende al menos un epítopo reconocido por el anticuerpo monoclonal BAT, seleccionado de un péptido que tiene la secuencia de cualquiera de […]

‹‹ Dispositivo de limpieza, desinfección, conservación y/o esterilización para instrumentos médicos, en particular dentales

Cerradura para puerta corredera ››