Tratamientos terapéuticos dirigidos.

Una composición que comprende al menos un conjugado HBn-Xn, en la que HB es un péptido de unión a heparina seleccionado entre KRKKKGKGLGKKRDPRLRKYK (SEQ ID NO:

2), MKRKKKGKGLGKKRDPRLRKYK (SEQ ID NO:21), KRKKKGKGLGKKRDPKLRKYK (SEQ ID NO:3); o MKRKKKGKGLGKKRDPKLRKYK (SEQ ID NO:22); X es un principio activo seleccionado de:

factor de crecimiento nervioso (NGF); factor neurotrófico derivado de cerebro (BDNF); neurotrofina-3 (NT-3); neurotrofina-4 (NT-4); factor neurotrófico ciliar (CNTF); factor neurotrófico mesencefálico derivado de astrocitos (MANF); factor neurotrófico de dopamina conservado (CDNF); ligandos de la familia del factor neurotrófico derivado de la línea celular glial; factor neurotrófico derivado de la línea celular glial (GDNF); neurturina (NRTN); artemina (ARTN); persefina (PSPN); citoquinas neuropoyéticas seleccionadas de interleuquina-6, interleucina-11, interleucina-27, factor inhibidor de leucemia, factor neurotrófico ciliar, cardiotrofina 1, neuropoyetina, citoquina de tipo cardiotropina o factor 2 de crecimiento de fibroblastos; citoquinas antiinflamatorias seleccionadas entre interleuquina-4 e interleuquina-10 del receptor 2 de TNF; neurregulina-1 y factor de crecimiento endotelial vascular (VEGF); Cerebrolysin® (FPF-1070); factor 11 de diferenciación del crecimiento (GDF11); factor 1 de derivado de células del estroma (SDF-1); miostatina (factor 8 de diferenciación del crecimiento de fibroblastos (GDF8)); factor 1 de crecimiento de tipo insulina (IGF1); hormona paratiroidea (HPT); una porción de la PTH, seleccionada entre los restos de aminoácidos 1-31,1-34 (TM Forteo ® ), 1-37, 1-38, 1-44, o 1-84 de la PTH madura; péptido relacionado con la hormona paratiroidea (PTHrP) o un análogo de la PTHrP que tiene la secuencia (AVSEHQLLHDKGKSIQDLRRRELLEKLLNKLHTA, donde N es Aib (ácido 2-aminoisobutírico) (SEQ ID NO: 39), antagonista del receptor de la interleuquina 1 (IL-IRA); quimeras IL-1/IL-1 RA; IL-1RA maduro que tiene la secuencia de aminoácidos: RPSGRKSSKMQAFRIWDVNQKTFYLRNLVAGYLQGPNVNLEEKIDVVPIEP HALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE (SEQ ID NO: 40), factor 18 de crecimiento de fibroblastos (FGF-18); proteína del grupo 2 de alta movilidad (HMG-2); un anticuerpo terapéutico seleccionado entre Remicade® (infliximab, anti-TNF-a), Humira® (adalimumab, anti-TNF), ENBREL® (etanercept, proteína recombinante anti-TNF); un anticuerpo dirigido contra el factor 9 de crecimiento nervioso; factor de crecimiento de fibroblastos (FGF-9); factor de crecimiento de hepatocitos; proteínas de la superfamilia de TGF-beta seleccionadas entre TGF, TGF3, BMP2, o BMP7; análogo de angiopoyetina 3 (ANGPTL3); un agente antiinflamatorio esteroideo seleccionado del grupo que consiste en 21-acetoxipregnenolona, alclometasona, algestona, amcinonida, beclometasona, betametasona, budesonida, cloroprednisona, clobetasol, clobetasona, clocortolona, cloprednol, corticosterona, cortisona, cortivazol, deflazacort, desonida, desoximetasona, dexametasona, diflorasona, diflucortolona, difluprednato, enoxolona, fluazacort, flucloronida, flumetasona, flunisolida, acetónido de fluocinolona, fluocinonida, fluocortin butilo, fluocortolona, fluorometolona, acetato de fluperolona, acetato de fluprednideno, fluprednisolona, flurandrenolida, propionato de fluticasona, formocortal, halcinonida, propionato de halobetasol, halometasona, acetato de halopredona, hidrocortamato, hidrocortisona, etabonato de loteprednol, mazipredona, medrisona, meprednisona, metilprednisolona, mometasona furoato, parametasona, prednicarbato, prednisolona, 25-dietilaminoacetato de prednisolona, fosfato de prednisolona sodio, prednisona, prednival, prednidileno, rimexolona, tixocortol, triamcinolona, acetónido de triamcinolona, benetónido de triamcinolona, y hexacetónido de triamcinolona; somatostatina (SST) o un análogo de la misma seleccionado entre las moléculas pequeñas (nombre comercial SANDOSTATIN® ), pasireotida (SOM230, nombre comercial SIGNIFOR®), lanreotida (nombre comercial: SOMATULINE® ); un principio activo de molécula pequeña seleccionado entre TR2-01829 o PRO 1,2-hidroxi-N-[3-(trifluorometil)fenil]benzamida (HS-Cf) o kartogenina y n es un número entero de al menos 1.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2013/047550.

Solicitante: THE BRIGHAM AND WOMEN'S HOSPITAL, INC..

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 75 FRANCIS STREET BOSTON MA 02115 ESTADOS UNIDOS DE AMERICA.

Inventor/es: LEE,Richard,T, PATWARI,PARTH, LOFFREDO,FRANCESCO, PANCOAST,JAMES.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/16 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00). › Péptidos que tienen más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.
  • A61P19/00 A61 […] › A61P ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS O DE PREPARACIONES MEDICINALES.Medicamentos para el tratamiento de problemas del esqueleto.
  • A61P25/00 A61P […] › Medicamentos para el tratamiento de trastornos del sistema nervioso.
  • A61P27/00 A61P […] › Medicamentos para tratar los trastornos de los sentidos.
  • C07K14/00 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.
  • C07K19/00 C07K […] › Péptidos híbridos (Inmoglobulinas híbridas compuestas   solamente de inmoglobulinas C07K 16/46).
  • C12N15/63 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K). › Introducción de material genético extraño utilizando vectores; Vectores; Utilización de huéspedes para ello; Regulación de la expresión.
  • C12N5/10 C12N […] › C12N 5/00 Células no diferenciadas humanas, animales o vegetales, p. ej. líneas celulares; Tejidos; Su cultivo o conservación; Medios de cultivo para este fin (reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00). › Células modificadas por introducción de material genético extraño, p. ej. células transformadas por virus.

PDF original: ES-2651113_T3.pdf

 

  • Fb
  • Twitter
  • G+
  • 📞

Patentes similares o relacionadas:

Glicopéptidos y azúcares pegilados unidos a glicerol, del 29 de Noviembre de 2017, de NOVO NORDISK A/S: Conjugado peptídico que comprende: a) un péptido que es factor IX y que se une covalentemente a un resto que es un miembro seleccionado de:**Fórmula** […]

Prevención de la reducción de enlaces disulfuro durante la producción recombinante de polipéptidos, del 29 de Noviembre de 2017, de GENENTECH, INC.: Un metodo para la prevencion de la reduccion de un enlace disulfuro en un polipeptido expresado en una celula hospedadora recombinante durante el procesamiento […]

Vector dual para la inhibición del virus de la inmunodeficiencia humana, del 15 de Noviembre de 2017, de Calimmune Inc: Un metodo para producir un vector de expresion virica que, cuando esta presente en una celula, es capaz de inhibir la union del VIH con la celula […]

Prevención de la reducción de enlaces disulfuro durante la producción recombinante de polipéptidos, del 1 de Noviembre de 2017, de GENENTECH, INC.: Un método para la prevención de la reducción de un enlace disulfuro en un polipéptido expresado en una célula hospedadora recombinante durante el […]

Biglicano y terapéuticas relacionadas y procedimientos de uso, del 1 de Noviembre de 2017, de BROWN UNIVERSITY RESEARCH FOUNDATION: Biglicano para su uso en el tratamiento o la prevención de una afección asociada a un complejo anormal de proteína asociada a distrofina (DAPC) en células de un sujeto, […]

Nanopartículas que contienen un péptido sensible al pH, del 11 de Octubre de 2017, de TAIHO PHARMACEUTICAL CO., LTD.: Un compuesto peptídico representado por la Fórmula (II) siguiente: R1-(Z1)l-[His- (AA1) (AA2) (AA3) - Glu/Asp]n-(Z2)m-R2 (II), en donde His es […]

Acondicionamiento angiogénico para potenciar la reprogramación celular cardiaca de fibroblastos del miocardio infartado, del 4 de Octubre de 2017, de CORNELL UNIVERSITY (100.0%): Combinación de vectores que comprende (a) un primer vector viral que codifica para una o más proteínas angiogénicas que inducen vascularización en el corazón […]

Copolímero-1, proceso para la preparación y sus métodos de análisis, del 27 de Septiembre de 2017, de USV Private Limited: Uso de fracciones de polipéptidos, como marcadores de pesos moleculares para acetato de glatiramer, en el que las fracciones de polipéptidos […]