Péptidos antigénicos de Neisseria.

Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2918 del documento WO99/57280 (MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPIANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAKLKAEKFNCYQSPMEKTEVCGGDFSTTIDRTKWGMDYLV NVGMTKSVRIDIQIEAAKQ),

en la que dicho(s) fragmento(s):

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de:

y en la que dicha proteína no es SEC ID Nº: 2916, 2918 ó 2920 del documento WO99/57280

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E10178490.

Solicitante: NOVARTIS VACCINES AND DIAGNOSITICS S.R.L.

Nacionalidad solicitante: Italia.

Dirección: Via Fiorentina 1 53100 Siena ITALIA.

Inventor/es: GRANDI, GUIDO, PIZZA, MARIAGRAZIA, RAPPUOLI, RINO, RATTI, GIULIO, GALEOTTI,CESIRA, MASIGNANI,VEGA, SCARLATO,VINCENZO, SCARSELLI,MARIA, MORA,MARIROSA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/095 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53). › Neisseria.
  • A61K39/40 A61K 39/00 […] › bacterianos.
  • A61K48/00 A61K […] › Preparaciones medicinales que contienen material genético que se introduce en las células del cuerpo vivo para tratar enfermedades genéticas; Terapia génica.
  • C07K14/22 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › de Neisseriaceae (F), p. ej. Acinetobacter.
  • C07K16/12 C07K […] › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra materiales bacterianos.
  • C12N15/31 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K). › Genes que codifican proteínas microbianas, p. ej. enterotoxinas.
  • G01N33/53 SECCION G — FISICA.G01 METROLOGIA; ENSAYOS.G01N INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION DE SUS PROPIEDADES QUIMICAS O FISICAS (procedimientos de medida, de investigación o de análisis diferentes de los ensayos inmunológicos, en los que intervienen enzimas o microorganismos C12M, C12Q). › G01N 33/00 Investigación o análisis de materiales por métodos específicos no cubiertos por los grupos G01N 1/00 - G01N 31/00. › Ensayos inmunológicos; Ensayos en los que interviene la formación de uniones bioespecíficas; Materiales a este efecto.
  • G01N33/569 G01N 33/00 […] › para microorganismos, p. ej. protozoarios, bacterias, virus.

PDF original: ES-2541830_T3.pdf

 


Fragmento de la descripción:

Péptidos antigénicos de Neisseria

CAMPO DE LA INVENCiÓN

La presente invención se refiere a secuencias de péptidos antigénicos de las bacterias Neisseria meningifidis.

TÉCNICA ANTERIOR

N. meningitidis es un diplococo Gram-negativo no móvil que es patógeno en seres humallOs Basándose en polisacárido capsular del organismo, se han identificado 12 serogrupos de N. meningifidis. El grupo A es el patógeno más frecuentemente implicado en la enfermedad epidémica en el África sub sahariana. Los serogrupos B y C son responsables de la gran mayoría de casos en los Estados Unidos y en la mayoría de los países desarrollados Los serogrupos W 135 e Y son responsables del resto de los casos en los Estados Unidos y países desarrollados.

La vacuna meningocócica actualmente en uso es una vacuna de polisacárido tetravalente compuesta de los serogrupos A, C y y W135 Sin embargo, el meningococo B sigue siendo un problema. El enfoque de polisacáridos no puede usarse debido a que el polisacárido capsular menB es un polímero del ácido N-acetilneuramínico enlazado a a (2-8) que también está presente en el tejido de mamifero. Un enfoque a una vacuna de menB usa mezclas de proteínas de la membrana externa (OMP) . Para superar la variabilidad antigénica, se han construido vacunas multivalentes que contienen hasta nueve porinas diferentes [por ejemplo, Poolman JT (1992) Development of a meningococcal vaccine. Infect. Agents Dis. 4:13-28]. Proteínas adicionales que van a usarse en las vacunas de la membrana extema han sido las proteínas opa y opc, pero ninguno de estos enfoques ha sido capaz de superar la variabilidad antigénica [por ejemplo, Ala'Aldeen & Borriello (1996) ]. Las proteínas 1 y 2 de unión a transferrina meningocócicas están ambas expuestas en la superficie y generan anticuerpos bactericidas capaces de aniquilar cepas homólogas y heterólogas. [Vaccine 14 (1) :49-53].

DIVULGACiÓN DE LA INVENCiÓN

La invención se refiere a fragmentos de la proteína 953 desvelada en las solicitudes de patente internaciooal W099/57280 y WOO0/22430 (las "solicitudes intemacionales") , en las que los fragmentos comprenden al menos un determinante antigénico, los fragmentos están seleccionadas de los 4 fragmentos de la reivindicación 1, Y la invención proporciona proteínas que comprenden uno o más de estos 5 fragmentos La invención está sometida a la condiciÓfl de que no incluye dentro de su alcance proteínas limitadas a cualquiera de las secuencias de proteína de longitud completa desveladas en las solicitudes intemacionales (es decir, las SEC ID N° 2-3020 pares de W099157280 y las SEC ID N° 963-1045 impares de WOO0f22430)

Las proteínas de la invención pueden prepararse, por supuesto, por diversos medios (por ejemplo, expresión recombinante, purificación a partir de cultivo celular, síntesis química, etc.) y en diversas formas (por ejemplo, fusiones nativas, del extremo C y/o extremo N, etc.) . Se preparan preferentemente en forma sustancialmente pura (es decir, sustancialmente libre de otras proteínas de Neisseria o de células huésped) . Se producen preferentemente proteínas cortas usando síntesis química de péptidos Según otro aspecto, la invención proporciona anticuerpos que recooocen los fragmentos de la invención, con la condición de que la invención no incluya dentro de su alcance anticuerpos que reconocen cualquiera de las secuencias de proteínas completas en las solicitudes internacionales. Los anticuerpos pueden ser polidonales o monoclooales, y pueden producirse por cualquier medio adecuado Composiciones que comprenden proteína ylo anticuerpo según la invención pueden ser adecuadas como vacunas, por ejemplo, o como reactivos de diagnóstico, o como composiciones inmunogénicas La proteína, o anticuerpo según la invenciórJ, puede usarse como medicamentos (por ejemplo, como vacunas o como composiciones inmunogénicas) o como reactivos de diagnóstico. Pueden usarse en la fabricación de: (i) un medicamento para tratar o prevenir infección debida a la bacteria de Neisseria; (ii) un reactivo de diagnóstico para detectar la presencia de bacterias de Neisseria o de anticuerpos producidos contra bacterias de Neisseria; ylo (iii) un reactivo que puede producir anticuerpos contra bacterias de Neisseria. Dichas bacterias de Neisseria pueden ser de cualquier especie o cepa (tal como N. gonorrlloeae) , pero son preferentemente N. meningitidis, especialmente la cepa A o la cepa B.

La divulgación también proporciona un método para tratar un paciente, que comprende administrar al paciente una cantidad terapéuticamente eficaz del ácido nucleico, proteína y/o anticuerpo según la invención.

Un resumen de las técnicas y procedimientos convencionales que pueden emplearse con el fin de realizar la invención (por ejemplo, utilizar las secuencias desveladas para vacunación o fines de diagnóstico) sigue a continuación. Este resumen no es una limitación de la invención, sino que más bien da ejemplos que pueden usarse, pero no se requieren.

General

La práctica de la presente invención empleará, a menos que se indique lo contrario, técnicas convencionales de biología molecular, microbiología, ADN recombinante e inmunología, que están dentro del conocimiento general de la técnica. Tales técnicas se explican completamente en la bibliografía, por ejemplo, Sambrook Molecular Cloning; A Laborator y Manual, segunda edición (1989) ; DNA Cloning, Volúmenes I and 11 (D.N Glover ed 1985) ; Oligonucleotide Synthesis (M.J. Gait ed, 1984) ; Nucleic Acid Hybridization (B.O. Hames & S.J. Higgins eds. 1984) ; Transcription and Translation (B.o. Hames & S.J. Higgins eds. 1984) ; Animal Cell Culture (R.1. Freshney ed. 1986) ; Immobilized Cells and Enzymes (IRL Press, 1986) ; B. Perbal, A Practical Guide to Molecular Cloning (1984) ; the Methods in Enzymology series (Academic Press, Inc.) , especialmente los volúmenes 154 y 155; Gene Transfer Vectors for Mammalian Cells (J.H. Miller and M.P. Calas eds. 1987, Cold Spring Harbar Laborator y ) ; Mayer and Walker, eds. (1987) , Immunochemical Methods in Cell and Molecular Biology (Academic Press, London) ; Scopes, (1987) Protein Purification: Principies and Practice, segunda edición (Springer-Verlag, NY) y Handbook of Experimental Immunology, Volúmenes I-IV (D.M. Weir and C. C. Blackwell eds 1986) . En esta memoria descriptiva se usan las abreviaciones estándar para nucleótidos y aminoácidos Definiciones Una composición que contiene X está ·sustancialmente libre de" Y cuando al menos el 85 % en peso del total X+Y en la composición es X. Preferentemente, X comprende al menos aproximadamente el 90 % en peso del total de X+Yen la composición, más preferentemente al menos aproximadamente el 95 % o incluso el 99 % en peso.

El término "que comprende" significa "que incluye", así como "que consiste", por ejemplo, una composición "que comprende" X puede consistir exclusivamente en X o puede incluir algo adicional a X, tal como X+Y

El término "determinante antigénico" incluye epítopes de linfocitos B y epítopes de linfocitos T.

El término "heterólogo" se refiere a dos componentes biológicos que no se encuentran junios en la naturaleza. Los componentes pueden ser células huésped, genes o regiones reguladoras, tales como promotores. Aunque los componentes heter6logos no se encuentran juntos en la naturaleza, pueden funcionar juntos, como cuando un promotor heterólogo a un gen está operativa mente ligado al gen. Otro ejemplo es donde una secuencia de Neisseria es heteróloga a una célula huésped de ratón. Un ejemplo adicional sería dos epítopes de las mismas proteínas o proteínas diferentes que se han ensamblado en una proteína individual en una disposición no encontrada en la naturaleza.

Un "origen de replicación" es una secuencia de polinucleótidos que inicia y regula la replicación de polinucleótidos, tal como un vector de expresión. El origen de replicación se comporta como una unidad autónoma de replicación de polinucleótidos dentro de una célula, capaz de la replicación bajo su propio control. Un origen de replicación puede ser necesario para que un vector se replique en una célula huésped particular. Con ciertos orígenes de replicación, un vector de expresión puede reproducirse en un alto número de copias en presencia de las proteínas apropiadas dentro de la célula. Ejemplos de orígenes son las secuencias autónomamente replicantes, que son eficaces en levadura; y el antígeno T viral, eficaz en células COS-7

Sistemas de expresión Las secuencias de nucleótidos meningocócicas pueden expresarse en una variedad de diferentes sistemas de expresión; por ejemplo, aquellos usados con células de mamífero, baculovirus, plantas, bacterias... [Seguir leyendo]

 


Reivindicaciones:

Una proleína que comprende uno o más fragmenlos de SEC ID N°-2918 del documento W099f57280 (MKKII FAALAAAAISTASAATYKVOEYHANARFAIDHFNTSTNVGGFYGL TGSVEFOQAKROGKIDITIPIANLQSGSQH FTDHLKSADIFDAAQYPDIRFVSTKFN FNGKKL VSVOGNL TMHGKTAPVKLKAEKFNCYQSPMEKTEVCGGOFSTIID

RTKWGMOYLV NVGMTKSVRIOIQIEAAKQ) , en la que dicho (s) fragmento (s) "

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de:

"~nThrS'HTilr"~nVa'lGlyGlyí'he"l'yrGlyL~, j'lhr 51

GlnSerG1YSerGlnH18PheThIAspH1SLeUL~sserA:a"spIlePheAspAlaAlaGln 95

ValGluPheAspGlnAlaLysArgA"spGlyLysIl~AspI.!.e 67 15 122 l~etHisGlyLysThrAl.aProyal LysLeuL"f~AlaGluLys 135

yen la que dicha proteína no es SEC ID N°" 2916, 2918 6 2920 del documento W099f57280

2_ Un anticuerpo que reconoce el fragmento como se define en la reivindicación 1


 

Patentes similares o relacionadas:

Cápside, del 3 de Mayo de 2019, de UCL BUSINESS PLC: Una proteína de la cápside del AAV que tiene una secuencia de aminoácidos que: (i) tiene la secuencia de SEQ ID NO: 3; o (ii) tiene al menos un 99 % de identidad […]

Modulación de BCL11A para el tratamiento de hemoglobinopatías, del 1 de Mayo de 2019, de THE CHILDREN'S MEDICAL CENTER CORPORATION: Una composición que comprende una célula progenitora hematopoyética que comprende un ácido nucleico que inhibe la expresión de BCL11A, en donde el ácido […]

Composiciones, kits y métodos para presentación de antígenos in vitro, evaluación de eficacia de vacunas y evaluación de la inmunotoxicidad de productos biológicos y fármacos, del 1 de Mayo de 2019, de UNIVERSITY OF MIAMI: Método de evaluación de una respuesta de células T frente a una vacuna o un producto biológico, comprendiendo el método las etapas de: a) preparar o proporcionar […]

Formulaciones parasiticidas inyectables de acción prolongada, del 30 de Abril de 2019, de MERIAL, INC.: Una formulación líquida inyectable de acción prolongada para combatir ectoparásitos y/o endoparásitos en un mamífero que comprende: (a) una cantidad […]

Vectores de terapia génica para la adrenoleucodistrofia y la adrenomieloneuropatía, del 25 de Abril de 2019, de Bluebird Bio, Inc: Vector lentiviral que comprende: (a) una LTR de VIH-1 izquierda (5'); (b) una señal de empaquetamiento Psi (Ψ ); (c) un tramo de polipurina […]

ARN que contiene nucleósidos modificados y métodos de uso del mismo, del 17 de Abril de 2019, de THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA: Un método no terapéutico para inducir a una célula de mamífero a producir una proteína recombinante, comprendiendo el método poner en contacto dicha célula […]

Anticuerpos anti-TNF, composiciones, métodos y usos, del 16 de Abril de 2019, de Janssen Biotech, Inc: anticuerpo específico para el factor de necrosis tumoral alfa (TNFα) que tiene tres CDRs de la cadena pesada y tres CDRs de la cadena ligera o un fragmento […]

Agente inductor de apoptosis, del 12 de Abril de 2019, de NITTO DENKO CORPORATION: Una composición para el uso en el tratamiento de cáncer debido a sobreexpresión de GST-π y mutación de KRAS, en la que la composición comprende como principios activos […]

Otras patentes de la CIP G01N33/569