44 inventos, patentes y modelos de GRANDI, GUIDO

Composiciones inmunogénicas.

Sección de la CIP Necesidades corrientes de la vida

(21/11/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS S.A.. Clasificación: A61K39/00, A61K39/02, A61K39/08, A61K39/09, A61K39/05, A61K39/13.

Una composición inmunogénica que comprende i) un conjugado que es un sacárido capsular del serotipo Ia del Estreptococo del Grupo B (GBS) conjugado con una proteína transportadora, ii) un conjugado que es un sacárido capsular del serotipo Ib del GBS conjugado con una proteína transportadora, iii) un conjugado que es un sacárido capsular del serotipo III del GBS conjugado con una proteína transportadora, iv) un toxoide diftérico, v) un toxoide tetánico y vi) un antígeno acelular de la tosferina y opcionalmente vii) un antígeno de poliovirus inactivado, en donde el iv) toxoide diftérico y v) toxoide tetánico no están conjugados.

PDF original: ES-2690526_T3.pdf

Composiciones inmunogénicas.

Sección de la CIP Necesidades corrientes de la vida

(30/05/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Clasificación: A61K39/09.

Una composición inmunogénica que comprende: (a) un producto conjugado que es un sacárido capsular de serotipo Ia del Grupo B de Streptococcus conjugado con una proteína portadora; (b) un producto conjugado que es un sacárido capsular de serotipo Ib del Grupo B de Streptococcus conjugado con una proteína portadora; y (c) un producto conjugado que es un polisacárido capsular de serotipo III del Grupo B de Streptococcus conjugado con una proteína portadora en donde (i) cada sacárido capsular de GBS está presente en una cantidad de aproximadamente 5 μg, 10 μg o 20 μg por dosis unitaria, (ii) la proteína portadora en (a), (b) y (c) es toxoide diftérico o CRM197 y (iii) la composición inmunogénica no contiene un coadyuvante de sal de aluminio.

PDF original: ES-2677358_T3.pdf

Vacunas de VME (vesículas de membrana externa).

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(21/02/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Clasificación: A61K39/00, C12N1/20, C07K14/295, A61K39/118, C07K14/245.

El uso de una bacteria mutante de ompA en la producción de vesículas de membrana externa que expresan un antígeno heterólogo sobre su superficie, en el que la bacteria es una E. coli que presenta el antígeno heterólogo sobre su superficie, en el que E. coli (a) no expresa la proteína OmpA, (b) expresa la lipoproteína de Braun lpp y (c) produce un aumento en el número de VME en comparación con su respectiva cepa de tipo silvestre que lleva un gen ompA de tipo silvestre.

PDF original: ES-2665044_T3.pdf

Péptidos antigénicos de Neisseriales.

Secciones de la CIP Necesidades corrientes de la vida Física Química y metalurgia

(22/03/2016). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS S.A.. Clasificación: A61K39/00, A61K48/00, G01N33/569, C12N15/09, C12N15/31, G01N33/53, C07K16/12, A61K39/095, A61K39/40, C07K14/22.

Una proteína que comprende uno o más fragmentos de una proteína que tiene una de las secuencias siguientes: i)**Fórmula** ii)**Fórmula** o iii) **Fórmula** en la que el fragmento comprende al menos un determinante antigénico y en la que el fragmento está seleccionado de:**Fórmula** con la condición de que la proteína no comprenda: **Fórmula**.

PDF original: ES-2564463_T3.pdf

Antígenos mutantes de GAS57 y anticuerpos de GAS57.

Sección de la CIP Necesidades corrientes de la vida

(26/02/2016). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Clasificación: A61K39/00.

Una composición de vacuna que comprende un antígeno GAS57 mutante purificado que comprende una alteración de aminoácidos en dos o más posiciones de aminoácidos seleccionados del grupo que consiste en los aminoácidos D151, H279 y S617, en la que las posiciones de aminoácidos están numeradas de acuerdo con la SEC ID Nº: 1 y 5 en la que la actividad proteolítica del antígeno GAS57 mutante purificado contra interleucina 8 (IL-8) se reduce en al menos un 50 % con respecto a GAS57 de tipo silvestre, según se detecta mediante electroforesis en gel de poliacrilamida-SDS o mediante un ensayo de ELISA.

PDF original: ES-2561483_T3.pdf

Péptidos antigénicos de Neisseria.

Secciones de la CIP Necesidades corrientes de la vida Física Química y metalurgia

(11/02/2016). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Clasificación: A61K39/00, A61K48/00, G01N33/569, C12N15/09, C12N15/31, G01N33/53, C07K16/12, A61K39/095, A61K39/40, C07K14/22.

Una proteína que comprende uno o más fragmentos de la SEC ID N.º: 1202 del documento WO99/57280 en la que dicho(s) fragmento(s):**Tabla** (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de**Tabla** y en la que dicha proteína no es SEC ID N.ºs: 1200, 1202, 1204, 3179, 3180, 3181, 3182, 3183, o 3184 del documento WO99/57280.

PDF original: ES-2559317_T3.pdf

Vacunas y agentes terapéuticos de GAS en combinación.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(10/02/2016). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Clasificación: C07K16/12, A61P31/04, C07K14/315, A61K39/09.

Una composición que comprende una combinación de tres antígenos proteicos de S. pyogenes (GAS), en la que los antígenos proteicos son: Spy0167, en el que el antígeno proteico Spy0167 tiene una secuencia de aminoácidos que es al menos 90 % idéntica a SEQ ID NO: 107; Spy0269, en el que el antígeno proteico Spy0269 tiene una secuencia de aminoácidos que es al menos 90 % idéntica a SEQ ID NO: 50; y Spy0416, en el que el antígeno proteico Spy0416 tiene una secuencia de aminoácidos que es al menos 90 % idéntica a SEQ ID NO: 1.

PDF original: ES-2566740_T3.pdf

Composiciones para inmunización contra Staphylococcus aureus.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(10/02/2016). Ver ilustración. Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Clasificación: A61K39/00, C07K14/31, A61K39/085.

Una vacuna que comprende antígeno sta006 para su uso en un procedimiento para proteger contra infección por S. aureus en un mamífero, en la que el antígeno sta006 comprende una secuencia de aminoácidos: (i) (a) que tiene 70 % o más de identidad con SEC. ID NO: 42; y/o (b) que comprende un fragmento de al menos "n" aminoácidos consecutivos de SEC. ID NO: 42, en el que "n" es 7 o más; y (ii) en la que el antígeno sta006 puede inducir un anticuerpo que reconoce SEC. ID NO: 42.

PDF original: ES-2565377_T3.pdf

Péptidos antigénicos de Neisseria.

(13/05/2015) Una proteína que comprende uno o más fragmentos de la proteína "961" seleccionados de:**Fórmula** que comprende al menos un determinante antigénico, y en la que dicha proteína no es SEQ ID NO:2944 del documento WO99/57280.

Péptidos antigénicos de Neisseria.

(08/04/2015) Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2918 del documento WO99/57280 (MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPIANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAKLKAEKFNCYQSPMEKTEVCGGDFSTTIDRTKWGMDYLV NVGMTKSVRIDIQIEAAKQ), en la que dicho(s) fragmento(s): (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de: y en la que dicha proteína no es SEC ID Nº: 2916, 2918 ó 2920 del documento WO99/57280

Péptidos antigénicos de Neisseria.

(25/03/2015) Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2884 del documento WO99/51280 (MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTDIAGDTWNTSKVRATLLGISPATQARVKIVTYG NVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR), en la que dicho(s) fragmento(s): (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de: **Fórmula** y en la que dicha proteína no es SEC ID Nº: 2876, 2878, 2880, 2882, 2884 o 2886 del documento WO99/57280 .

Antígenos de Neisseria meningitidis.

(18/03/2015) Una proteína que comprende una secuencia de aminoácidos antigénica con homología de secuencia del 80% o superior con SEC ID Nº 2 ó SEC ID Nº 4, con la condición de que dicha proteína no sea (i) una proteína que tiene la secuencia de aminoácidos SEC ID Nº 7, ó (ii) un fragmento de SEC ID Nº 7.

Antígenos y composiciones de neisseria meningitidis.

(04/03/2015) Una composición que comprende una proteína aislada que comprende: (i) una secuencia de aminoácidos seleccionada del grupo consistente de las SEQ IDs 2918, 2916 y 2920; o (ii) una secuencia de aminoácidos que tiene un 90% o más de identidad de secuencia con una secuencia de aminoácidos seleccionada del grupo consistente de las SEQ IDs 2918, 2916 y 2920.

Vacuna de estreptococo del grupo B.

(16/07/2014) Una composición inmunogénica que comprende: a. uno o más antígenos de polipéptido GBS, y b. antígenos de sacárido GBS de GBS serotipos Ia, Ib y III, donde la composición comprende GBS80 o un fragmento inmunogénica del mismo.

Composiciones inmunógenas para Streptococcus pyogenes.

(09/07/2014) Composición inmunógena que comprende una combinación de antígenos de GAS, consistiendo dicha combinación en dos a diez antígenos de GAS, en la que dicha combinación incluye GAS40, siendo dicho "GAS40" una proteína que comprende una secuencia de aminoácidos (a) que tiene un 95% o más identidad con la SEQ ID NO: 1 y/o (b) que es un fragmento de al menos 200 aminoácidos consecutivos de la SEQ ID NO: 1 y en la que dicha combinación incluye GAS57, siendo dicho "GAS57" una proteína que comprende una secuencia de aminoácidos (a) que tiene un 95% o más identidad con la SEQ ID NO: 116 y/o (b) que es un fragmento de al menos 200 aminoácidos consecutivos de la SEQ ID NO: 116.

Vesículas bacterianas inmunogénicas con proteínas de membrana externa.

(25/06/2014) Una bacteria de Escherichia coli patógena, que no expresa una proteína del complejo Tol-Pal y/o que tiene una mutación de bloqueo de su gen mltA

Formas mutantes de estreptolisina O.

(01/08/2012) Una proteína de estreptolisina O (SLO) mutante purificada según SEC ID Nº: 1, en la que los aminoácidos en lasposiciones P427 y W535 están sustituidos con otro aminoácido, y en la que la actividad hemolítica de la proteínaSLO mutante se reduce al menos el 50 % con respecto a SLO natural.

Inmunización contra Chlamydia trachomatis.

(23/05/2012) Una proteína para su uso en el tratamiento o la prevención de infección debida a Chlamydia trachomatis, en laque la proteína es (a) una proteína que comprende la secuencia de aminoácidos SEC ID 255, (b) una proteína quecomprende una secuencia de aminoácidos que tiene una identidad de secuencia del 50 % o más con la secuenciade aminoácidos de (a), o (c) una proteína que comprende un fragmento de al menos 7 aminoácidos consecutivos deSEC ID 255.

CONFÓRMEROS DE ADHESINAS BACTERIANAS.

(14/12/2011) Una adhesina bacteriana aislada en el confórmero F, en la que la adhesina bacteriana puede generar una respuesta inmunitaria en un sujeto, en la que la adhesina bacteriana en el confórmero F no queda retenida por una columna de Q-sefarosa, y en la que la adhesina bacteriana es GBS80

COMPOSICIONES INMUNÓGENAS PARA STREPTOCOCCUS AGALACTIAE.

(12/07/2011) Una composición que es isotónica con respecto a los seres humanos y/o está liofilizada, composición que comprende una combinación de dos o más antígenos GBS, en la que dicha combinación incluye: i) GBS 80 que comprende la secuencia de aminoácidos de SEC ID N.º 2 o un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma; y ii) al menos uno entre GBS 91 que comprende la secuencia de aminoácidos de SEC ID N.º 11, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 104 que comprende la secuencia de aminoácidos de SEC ID N.º 19, un fragmento inmunógeno…

PROTEÍNA PORTADORA DE POLIEPÍTOPOS.

(03/03/2011) Una proteína portadora que comprende 10 a 20 epítopos CD4+ de linfocitos T

PROTEINA RECEPTORA CD81 DE LA HEPATITIS C.

(15/03/2010) Un fragmento EC2 de la proteína CD81, que consta de los aminoácidos 113-201 de la secuencia de CD81 humano enumerado en la base de datos SWISSPROT (nº de registro P18582) o la base de datos EMBL/GENBANK (nº de registro M33680), o que tiene, al menos, una homología del 80% con los aminoácidos 113-201 de la secuencia de CD81 humana, en la que la homología se define usando el paquete de software de análisis de secuencia Pileup (Wisconsin, 1996), para usar en el tratamiento o diagnóstico de la infección por VHC

ANTIGENOS DE NEISSERIA MENINGITIDIS.

(16/02/2010) Una proteína que comprende una secuencia de aminoácidos antigénica con homología de secuencia del 80% o superior con SEC ID Nº 2 ó SEC ID Nº 4, con la condición de que dicha proteína no sea (i) una proteína que tiene la secuencia de aminoácidos SEC ID Nº 7, ó (ii) un fragmento de SEC ID Nº 7

ACIDOS NUCLEICOS Y PROTEINAS DE ESTREPTOCOCOS DE LOS GRUPOS A Y B.

Sección de la CIP Química y metalurgia

(04/12/2009). Solicitante/s: CHIRON S.P.A. THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C07K14/315, C07K14/195.

Una proteína que induce una inmunidad protectora contra Streptococcus agalactiae que comprende: (a) una secuencia de aminoácidos seleccionada del grupo constituido por las SEC ID 2 y 4; (b) una secuencia de aminoácidos que tiene una identidad de secuencia del 80% o superior con la SEC ID 2 ó 4; o (c) un fragmento de n o más aminoácidos consecutivos a partir de la secuencia de aminoácidos SEC ID 2 o SEC ID 4 donde n es 10, con la condición de que la proteína de (b) o (c) no sea: (i) los 246 aminoácidos C-terminales de la SEC ID 2; o (ii) un 245-mero que son los aminoácidos 336 a 580 de la SEC ID.

SECUENCIAS GENOMICAS DE NEISSERIA Y PROCEDIMIENTOS DE USO.

Sección de la CIP Química y metalurgia

(27/07/2009). Ver ilustración. Solicitante/s: CHIRON CORPORATION THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C12Q1/68, C12N15/11, C07K14/22.

Una proteína constituida por la secuencia de aminoácidos codificada por los nucleótidos 1363680 a 1364114 de la SEC DE ID Nº: 1.

PROTEINA NAP DE HELICOBACTER PYLORI.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Física

(17/06/2009). Ver ilustración. Solicitante/s: CHIRON S.P.A.. Clasificación: A61K39/00, C07K16/12, C12N15/00, C07K14/205, G01N30/02.

Un procedimiento para enriquecer la presencia de NAP de H. pylori en una mezcla de proteínas, que comprende las etapas de precipitación por saturación y cromatografía con quelado metálico, en el que la concentración final de sales de la etapa de precipitación por saturación es de una saturación de al menos el 50%.

ANTIGENOS Y COMPOSICIONES DE NEISSERIA MENINGITIDIS.

Secciones de la CIP Química y metalurgia Física Necesidades corrientes de la vida

(01/09/2008). Ver ilustración. Solicitante/s: CHIRON CORPORATION THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C12N15/31, C12Q1/68, G01N33/50, C07K16/12, A61K39/095, C07K14/22.

Una proteína que comprende: * la secuencia de aminoácidos SEQ ID Nº: 2: * una secuencia de aminoácidos que tiene identidad de secuencia mayor del 50% con la secuencia de aminoácidos SEQ ID Nº: 2; o * un fragmento de una secuencia de aminoácidos SEQ ID Nº: 2, en el que dicho fragmento comprende 7 ó más aminoácidos consecutivos de dicha secuencia.

PROCEDIMIENTO DE DISEÑO DE FARMACOS EN BASE A LA ESTRUCTURA PARA IDENTIFICAR COMPUESTOS QUE SE UNEN A CD81, UN RECEPTOR CELULAR DEL VIRUS DE LA HEPATITIS C.

Secciones de la CIP Química y metalurgia Física

(16/04/2007). Solicitante/s: CHIRON SPA. Clasificación: C07K14/705, G01N33/50.

REIVINDICACIONES 1. Un procedimiento basado en ordenador para identificar un ligando para el CD81, que comprende los pasos de: (a) proporcionar una representación estructural en 3D del bucle extracelular grande de CD81 en un medio de almacenamiento en un ordenador, en el que la representación estructural en 3D se deriva de las coordenadas atómicas cd81lel.pdb o una variante de cd811lel.pdb en el cual la des-viación R.M.S. de las coordenadas X, Y y Z de todos los átomos pesa-dos es menor que 2, 5 Amstrong, y (b) utilizar el ordenador para aplicar técnicas de diseño de fármacos basa-do en estructura a la representación estructural.

VECTOR RECOMBINANTE PARA LA PREPARACION EXOCELULAR DE ANTICUERPOS MONOCATENARIOS EXPRESADOS EN BACILLUS SUBTILIS.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(16/11/2000). Solicitante/s: ENITECNOLOGIE S.P.A.. Clasificación: C07K14/00, C12N15/13, C12N15/62, A61K39/395, C07K16/00, C12N15/75.

SE DESCRIBE UN VECTOR RECOMBINANTE PARA LA EXPRESION Y SECRECION DE ANTICUERPOS EN FORMA DE MOLECULA SIMPLE (SCFV) EN B. SUBTILIS, DONDE DICHO VECTOR COMPRENDE EL PROMOTOR DEL GEN PARA PROTEASA NEUTRA, UNA NUEVA SECUENCIA DE SECRECION (I) Y UNA SECUENCIA DNA QUE CODIFICA PARA UN ANTICUERPO SCFV DE INTERES, UNA CEPA DE B. SUBTILIS TRANSFORMADA CON DICHO VECTOR RECOMBINANTE, Y UN PROCEDIMIENTO PARA LA PRODUCCION EXOCELULAR DE ANTICUERPOS SCFV POR MEDIO DE UN CULTIVO DE DICHA CEPA DE B. SUBTILIS. EL VECTOR RECOMBINANTE PERMITE LA EXPRESION DE SCFV EN UNA FORMA COMPLETAMENTE SOLUBLE Y SU SECRECION CON ELEVADO RENDIMIENTO.

REGIONES PROMOTORAS DE LOS GENES QUE CODIFICAN LAS SUBUNIDADES PILIMICAS FIM2, FIM3 Y FIMX DE LA TOSFERINA DE BORDETELLA Y SU USO PARA LA EXPRESION DE GENES QUE CODIFICAN UNA PROTEINA DE INTERES.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(01/04/1998). Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/74, C12N15/31, C12N1/21, A61K39/10.

SE DESCRIBEN EL AISLAMIENTO Y CARACTERIZACION DE LAS REGIONES PROMOTORAS DE LOS GENES QUE CODIFICAN LAS SUBUNIDADES PILIMICAS FIM2, FIM3 Y FIMX DE LA TOSFERINA DE BORDETELLA, QUE CONTIENEN ASI COMO LA CONSTRUCCION DE VECTORES QUE CONTIENEN LAS REGIONES, Y LOS MICROORGANISMOS TRANSFORMADOS POR LOS VECTORES. LAS REGIONES PROMOTORAS, O FRAGMENTOS NUCLEOTIDOS DE LAS MISMAS, SON PARTICULARMENTE UTILES PARA LA EXPRESION DE GENES REGULABRES O NO-REGULABLES QUE CODIFICAN UNA PROTEINA DE INTERES EN UNA DEFORMACION DE BORDETELLA. LAS DEFORMACIONES DE BORDETELLA TRANSFORMADAS SON PARTICULARMENTE UTILES PARA EL DESARROLLO DE UNA VACUNA ANTI-TOSFERINA EFICAZ.

PROCESO PARA LA PRODUCCION DE D-ALFA-AMINOACIDOS.

Sección de la CIP Química y metalurgia

(01/11/1997). Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/55, C12P41/00, C12N1/21.

SE DESCRIBE UN PROCESO PARA LA PRODUCCION DE D-ALFA-AMINOACIDOS A TRAVES DE LA CONVERSION ESTEREOESPECIFICA DE MEZCLAS RACEMICAS DE 5-SUBSTITUIDOS HIDANDOINOS, SIENDO DICHA CONVERSION LLEVADA A CABO EN PRESENCIA DE UN MICROORGANISMO TRANSFORMADO CON UN PLASMIDO CAPAZ DE MANIFESTARSE,A ALTOS NIVELES Y SIN INDUCTORES, UN SISTEMA ENZIMATICO CAPAZ DE CONVERTIR DICHOS HIDANDOINOS EN SUS CORRESPONDIENTES D-ALFA-AMINOACIDOS. TAMBIEN SE DESCRIBE UN LASMIDO QUE CONTIENE LOS GENES QUE INCLUYEN DICHO SISTEMA ENZIMATICO Y UN MICROORGANISMO SELECCIONADO DE ESCHERICHIA COLI O BACILLUS SUBTILIS TRANSFORMADOS CON DICHO PLASMIDO. LOS D-ALFA-AMINOACIDOS SON INTERMEDIARIOS UTILES EN LA PREPARACION DE SUSTANCIAS FARMACOLOGICAMENTE ACTIVAS, PESTICIDAS Y ENDULCORANTES.

PROCESO PARA LA PREPARACION DE POLIPEPTIDOS MADUROS POR DIVISION ENZIMATICA CON FACTOR XA.

Sección de la CIP Química y metalurgia

(01/10/1997). Solicitante/s: PHARMACIA & UPJOHN AKTIEBOLAG. Clasificación: C12N15/62, C12P21/06, C07K2/00, C12N11/10.

PROCESO PARA LA PREPARACION DE POLIPEPTIDOS MADUROS POR DIVISION ENZIMATICA CON FACTOR XA. LA PRESENTE INVENCION ESTA RELACIONADA CON LA PREPARACION DE POLIPEPTIDOS MADUROS POR HIDROLISIS ENZIMATICA DE PRECURSORES SOLUBLES CON FACTOR XA INMOVILIZADO EN UN SOPORTE DE SOLIDO INSOLUBLE. EL USO DEL ENZIMA INMOVILIZADO SIMPLIFICA EL PROCESO DE PRODUCCION DEL PRODUCTO ACABADO, MINIMIZA LA PROBABILIDAD DE QUE SE CONTAMINE EL PRODUCTO FINAL POR CAUSA DEL ENZIMA O DE LOS PRODUCTOS DE AUTOLISIS O DE OTRAS PROTEINAS DE ORIGEN ANIMAL Y POSIBILITA EL USO REPETIDO DEL MISMO SOPORTE Y UN CONTROL MEJOR DE LA HIDROLISIS DEL PRECURSOR.

1 · ››