Péptidos antigénicos de Neisseria.

Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2884 del documento WO99/51280 (MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTDIAGDTWNTSKVRATLLGISPATQARVKIVTYG NVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR),

en la que dicho(s) fragmento(s):

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de: **Fórmula**

y en la que dicha proteína no es SEC ID Nº: 2876, 2878, 2880, 2882, 2884 o 2886 del documento WO99/57280 .

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E10179001.

Solicitante: NOVARTIS VACCINES AND DIAGNOSITICS S.R.L.

Nacionalidad solicitante: Italia.

Dirección: Via Fiorentina 1 53100 Siena ITALIA.

Inventor/es: GRANDI, GUIDO, PIZZA, MARIAGRAZIA, RAPPUOLI, RINO, RATTI, GIULIO, GALEOTTI,CESIRA, MASIGNANI,VEGA, SCARLATO,VINCENZO, SCARSELLI,MARIA, MORA,MARIROSA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/095 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53). › Neisseria.
  • A61K39/40 A61K 39/00 […] › bacterianos.
  • A61K48/00 A61K […] › Preparaciones medicinales que contienen material genético que se introduce en las células del cuerpo vivo para tratar enfermedades genéticas; Terapia génica.
  • C07K14/22 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › de Neisseriaceae (F), p. ej. Acinetobacter.
  • C07K16/12 C07K […] › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra materiales bacterianos.
  • C12N15/31 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K). › Genes que codifican proteínas microbianas, p. ej. enterotoxinas.
  • G01N33/53 SECCION G — FISICA.G01 METROLOGIA; ENSAYOS.G01N INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION DE SUS PROPIEDADES QUIMICAS O FISICAS (procedimientos de medida, de investigación o de análisis diferentes de los ensayos inmunológicos, en los que intervienen enzimas o microorganismos C12M, C12Q). › G01N 33/00 Investigación o análisis de materiales por métodos específicos no cubiertos por los grupos G01N 1/00 - G01N 31/00. › Ensayos inmunológicos; Ensayos en los que interviene la formación de uniones bioespecíficas; Materiales a este efecto.
  • G01N33/569 G01N 33/00 […] › para microorganismos, p. ej. protozoarios, bacterias, virus.

PDF original: ES-2539951_T3.pdf

 


Fragmento de la descripción:

Péptidos antigénicos de Neisseria.

CAMPO DE LA INVENCIÓN 5

La presente invención se refiere a secuencias de péptidos antigénicos de las bacterias Neisseria meningitidis.

TÉCNICA ANTERIOR

N. meningitidis es un diplococo Gram-negativo no móvil que es patógeno en seres humanos.

Basándose en polisacárido capsular del organismo, se han identificado 12 serogrupos de N. meningitidis. El grupo A es el patógeno más frecuentemente implicado en la enfermedad epidémica en el África subsahariana. Los serogrupos B y C son responsables de la gran mayoría de casos en los Estados Unidos y en la mayoría de los 15 países desarrollados. Los serogrupos W 135 e Y son responsables del resto de los casos en los Estados Unidos y países desarrollados.

La vacuna meningocócica actualmente en uso es una vacuna de polisacárido tetravalente compuesta de los serogrupos A, C Y y W135. Sin embargo, el meningococo B sigue siendo un problema. El enfoque de polisacáridos 20 no puede usarse debido a que el polisacárido capsular menB es un polímero del ácido N-acetilneuramínico enlazado a α (2-8) que también está presente en el tejido de mamífero. Un enfoque a una vacuna de menB usa mezclas de proteínas de la membrana externa (OMP) . Para superar la variabilidad antigénica, se han construido vacunas multivalentes que contienen hasta nueve porinas diferentes [por ejemplo, Poolman JT (1992) Development of a meningococcal vaccine. Infect. Agents Dis. 4:13-28]. Proteínas adicionales que van a usarse en las vacunas de la 25 membrana externa han sido las proteínas opa y opc, pero ninguno de estos enfoques ha sido capaz de superar la variabilidad antigénica [por ejemplo, Ala'Aldeen & Borriello (1996) ]. Las proteínas 1 y 2 de unión a transferrina meningocócicas están ambas expuestas en la superficie y generan anticuerpos bactericidas capaces de aniquilar cepas homólogas y heterólogas. [Vaccine 14 (1) :49-53].

DIVULGACIÓN DE LA INVENCIÓN

La invención se refiere a fragmentos de la proteína 936-1 desvelada en las solicitudes de patente internacional WO99/57280 y WO00/22430 (las “solicitudes internacionales”) , en las que los fragmentos comprenden al menos un determinante antigénico y están seleccionadas de los 5 fragmentos de la reivindicación 1, y la invención también 35 proporciona proteínas que comprenden uno o más de estos 5 fragmentos.

La invención está sometida a la condición de que no incluye dentro de su alcance proteínas limitadas a cualquiera de las secuencias de proteína de longitud completa desveladas en las solicitudes internacionales (es decir, las SEC ID Nº 2-3020 pares de WO99/57280 y las SEC ID Nº 963-1045 impares de WO00/22430) . 40

Las proteínas de la invención pueden prepararse, por supuesto, por diversos medios (por ejemplo, expresión recombinante, purificación a partir de cultivo celular, síntesis química, etc.) y en diversas formas (por ejemplo, fusiones nativas, del extremo C y/o extremo N, etc.) . Se preparan preferentemente en forma sustancialmente pura (es decir, sustancialmente libre de otras proteínas de Neisseria o de células huésped) . Se producen preferentemente 45 proteínas cortas usando síntesis química de péptidos.

Según otro aspecto, la invención proporciona anticuerpos que reconocen los fragmentos de la invención, con la condición de que la invención no incluya dentro de su alcance anticuerpos que reconocen cualquiera de las secuencias de proteínas completas en las solicitudes internacionales. Los anticuerpos pueden ser policlonales o 50 monoclonales, y pueden producirse por cualquier medio adecuado.

Composiciones que comprenden proteína y/o anticuerpo según la invención pueden ser adecuadas como vacunas, por ejemplo, o como reactivos de diagnóstico, o como composiciones inmunogénicas.

La proteína, o anticuerpo según la invención, puede usarse como medicamentos (por ejemplo, como vacunas o como composiciones inmunogénicas) o como reactivos de diagnóstico. Pueden usarse en la fabricación de: (i) un medicamento para tratar o prevenir infección debida a la bacteria de Neisseria; (ii) un reactivo de diagnóstico para detectar la presencia de bacterias de Neisseria o de anticuerpos producidos contra bacterias de Neisseria; y/o (iii) un reactivo que puede producir anticuerpos contra bacterias de Neisseria. Dichas bacterias de Neisseria pueden ser de 60 cualquier especie o cepa (tal como N. gonorrhoeae) , pero son preferentemente N. meningitidis, especialmente la cepa A o la cepa B.

La divulgación también proporciona un método para tratar un paciente, que comprende administrar al paciente una cantidad terapéuticamente eficaz del ácido nucleico, proteína y/o anticuerpo según la invención. 65

Un resumen de las técnicas y procedimientos convencionales que pueden emplearse con el fin de realizar la invención (por ejemplo, utilizar las secuencias desveladas para vacunación o fines de diagnóstico) sigue a continuación. Este resumen no es una limitación de la invención, sino que más bien da ejemplos que pueden usarse, pero no se requieren.

General

La práctica de la presente invención empleará, a menos que se indique lo contrario, técnicas convencionales de biología molecular, microbiología, ADN recombinante e inmunología, que están dentro del conocimiento general de la técnica. Tales técnicas se explican completamente en la bibliografía, por ejemplo, Sambrook Molecular Cloning; A 10 Laborator y Manual, segunda edición (1989) ; DNA Cloning, Volúmenes I and II (D.N Glover ed. 1985) ; Oligonucleotide Synthesis (M.J. Gait ed, 1984) ; Nucleic Acid Hybridization (B.D. Hames & S.J. Higgins eds. 1984) ; Transcription and Translation (B.D. Hames & S.J. Higgins eds. 1984) ; Animal Cell Culture (R.I. Freshney ed. 1986) ; Immobilized Cells and Enzymes (IRL Press, 1986) ; B. Perbal, A Practical Guide to Molecular Cloning (1984) ; the Methods in Enzymology series (Academic Press, Inc.) , especialmente los volúmenes 154 y 155; Gene Transfer 15 Vectors for Mammalian Cells (J.H. Miller and M.P. Calos eds. 1987, Cold Spring Harbor Laborator y ) ; Mayer and Walker, eds. (1987) , Immunochemical Methods in Cell and Molecular Biology (Academic Press, London) ; Scopes, (1987) Protein Purification: Principles and Practice, segunda edición (Springer-Verlag, N.Y.) y Handbook of Experimental Immunology, Volúmenes I-IV (D.M. Weir and C. C. Blackwell eds 1986) . En esta memoria descriptiva se usan las abreviaciones estándar para nucleótidos y aminoácidos. 20

Definiciones

Una composición que contiene X está “sustancialmente libre de” Y cuando al menos el 85 % en peso del total X+Y en la composición es X. Preferentemente, X comprende al menos aproximadamente el 90 % en peso del total de 25 X+Y en la composición, más preferentemente al menos aproximadamente el 95 % o incluso el 99 % en peso.

El término “que comprende” significa “que incluye”, así como “que consiste”, por ejemplo, una composición “que comprende” X puede consistir exclusivamente en X o puede incluir algo adicional a X, tal como X+Y.

El término “determinante antigénico” incluye epítopes de linfocitos B y epítopes de linfocitos T.

El término “heterólogo” se refiere a dos componentes biológicos que no se encuentran juntos en la naturaleza. Los componentes pueden ser células huésped, genes o regiones reguladoras, tales como promotores. Aunque los componentes heterólogos no se encuentran juntos en la naturaleza, pueden funcionar juntos, como cuando un 35 promotor heterólogo a un gen está operativamente ligado al gen. Otro ejemplo es donde una secuencia de Neisseria es heteróloga a una célula huésped de ratón. Un ejemplo adicional sería dos epítopes de las mismas proteínas o proteínas diferentes que se han ensamblado en una proteína individual en una disposición no encontrada en la naturaleza.

Un “origen de replicación” es una secuencia de polinucleótidos que inicia y regula la replicación de polinucleótidos, tal como un vector de expresión. El origen de replicación se comporta como una unidad autónoma de replicación de polinucleótidos dentro de una célula, capaz de la replicación bajo su propio control. Un origen de replicación puede ser necesario para que un vector se replique en una célula huésped particular. Con ciertos orígenes de replicación, un vector de expresión puede reproducirse en un alto número de copias en presencia de las proteínas apropiadas 45 dentro de la célula. Ejemplos de orígenes son las secuencias autónomamente replicantes, que son eficaces en levadura; y el antígeno T viral, eficaz en células COS-7.... [Seguir leyendo]

 


Reivindicaciones:

1. Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2884 del documento WO99/51280 (MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTAGDIAGDTWNTSKVRATLLGISPATQARVKIVTYG NVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR) , en la que dicho (s) fragmento (s) : 5

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de:

y en la que dicha proteína no es SEC ID Nº: 2876, 2878, 2880, 2882, 2884 o 2886 del documento WO99/57280

2. Un anticuerpo que reconoce el fragmento como se define en la reivindicación 1.


 

Patentes similares o relacionadas:

Composiciones útiles en el tratamiento de la deficiencia de ornitina transcarbamilasa (OTC), del 8 de Julio de 2020, de THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA: Un vector vírico recombinante que comprende una secuencia de ácido nucleico que codifica la proteína ornitina transcarbamilasa humana (hOTC) y secuencias […]

Terapia génica para la diabetes, del 8 de Julio de 2020, de UCL Business Ltd: Una molécula de ácido nucleico que comprende una secuencia de nucleótidos que codifica una proteína preproinsulina funcional en donde la secuencia de nucleótidos tiene al menos […]

Vacuna de ADN que contiene un epítopo específico de VEGF y/o un epítopo específico de angiopoyetina-2, del 1 de Julio de 2020, de OSAKA UNIVERSITY: Un vector de expresión que codifica un polipéptido del antígeno del núcleo del virus de la hepatitis B quimérico con una inserción para uso en el tratamiento o la profilaxis […]

Composiciones para modular la expresión de SOD-1, del 24 de Junio de 2020, de Biogen MA Inc: Un compuesto antisentido según la siguiente fórmula: mCes Aeo Ges Geo Aes Tds Ads mCds Ads Tds Tds Tds mCds Tds Ads mCeo Aes Geo mCes Te (secuencia […]

Ácido nucleico antisentido, del 24 de Junio de 2020, de NIPPON SHINYAKU CO., LTD.: Un oligómero antisentido de 14 a 32 bases de longitud, que comprende dos unidades de oligómeros conectadas seleccionadas del grupo que consiste […]

Plekhg5 como diana farmacéutica para trastornos neurológicos, del 15 de Junio de 2020, de CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS (CSIC): Plekhg5 como diana farmacéutica para trastornos neurológicos. La invención hace referencia al uso del gen Plekhg5 como diana farmacológica para el cribado, […]

Vectores de AAV dirigidos a oligodendrocitos, del 10 de Junio de 2020, de THE UNIVERSITY OF NORTH CAROLINA AT CHAPEL HILL: Un ácido nucleico que codifica una cápside de AAV, comprendiendo el ácido nucleico una secuencia codificante de la cápside de AAV que es al menos el 96 % idéntica […]

Método para activar células T auxiliares, del 10 de Junio de 2020, de OTSUKA PHARMACEUTICAL CO., LTD.: Una composición para su uso en el tratamiento o prevención del cáncer mediante la activación de células T auxiliares en un sujeto, en donde dicha composición […]

Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .