Anticuerpos dirigidos contra la proteína 1 quimioatrayente de monocitos (MCP-1 N1pE) de piroglutamato.

Un anticuerpo que se une selectivamente al extremo amino que lleva piroglutamato de MCP-1

(MCP-1N1pE), en el que unión selectiva significa que no muestra ninguna reactividad cruzada con epítopos fuera del extremo amino que lleva piroglutamato de MCP-1N1pE.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2009/060757.

Solicitante: PROBIODRUG AG.

Nacionalidad solicitante: Alemania.

Dirección: WEINBERGWEG 22 06120 HALLE/SAALE ALEMANIA.

Inventor/es: DEMUTH, HANS-ULRICH, SCHILLING,STEPHAN, CYNIS,Holger, GANS,KATHRIN, KAMPFER,SONJA, RAHFELD,JENS-ULRICH.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/24 (contra citoquinas, linfoquinas o interferones)

PDF original: ES-2533493_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Anticuerpos dirigidos contra la proteína 1 quimioatrayente de monocitos (MCP-1 N1pE) de piroglutamato Antecedentes de la invención Campo de la invención

La presente invención se refiere a anticuerpos monoclonales que se unen específicamente a la atocina proinflamatoria piroglutamato MCP-1 (MCP-1 N1pE).

Estado de la técnica relacionado

Las atocinas quimiotácticas (quimiocinas) son proteínas que atraen y activan leucocitos y se cree que desempeñan una fundón fundamental en la inflamación. Las quimiocinas se dividen en cuatro grupos clasificados por la aparición de residuos de cisteína del extremo N (C-; CC-; CXC- y CX3C-quimiocinas). Las CXC-quimiocinas actúan preferendalmente sobre neutrófilos. A diferencia, las CC-qu¡miocinas atraen preferencialmente monocitos a sitios de inflamación. La infiltración de monocitos se considera que es un acontecimiento clave en varias condiciones de enfermedad (Gerard, C. y Rollins, B. J. (21) Nat. lmmunol2, 18-115; Bhatia, M. y col., (25) Pancreatology. 5, 132- 144; Kitamoto, S., Egashira, K., y Takeshita, A. (23) J Pharmacol Sci. 91,192-196).

La familia de MCP, como una familia de las quimiocinas, consiste en cuatro miembros (MCP-1 a 4), que muestran preferencia por atraer monocitos, pero que muestran diferencias en su potencial (Luini, W. y col., (1994) Cytokine 6, 28- 31; Uguccioni, M. y col., (1995) Eur J Immunol 25, 64-68).

MCP-1 es un miembro de la subfamilia p (C-C) de quimiocinas. En esta familia, las 2 cisternas más próximas al extremo amino están adyacentes entre sí (así las proteínas C-C). Como con muchas otras C-C-quimiocinas, el gen MCP-1 está localizado sobre el cromosoma 17 en seres humanos. Los receptores de la superficie celular que se unen a MCP-1 son CCR2 y CCR5.

A continuación se indican ambos ADNc, además de secuencias de aminoácidos de MCP-1:

MCP-1 humana (CCL2) (Acceso de GeneBank: M24545)

ADNc (3 pb) SEQ ID NO: 2

atgaaagtct

ctgccgccct

tctgtgcctg

ctgctcatag

cagccacctt

cattccccaa

61

gggctcgctc

agccagatgc

aatcaatgcc

ccagtcacct

gctgttataa

cttcaccaat

121

aggaagatct

cagtgcagag

gctcgcgagc

tatagaagaa

tcaccagcag

caagtgtccc

181

aaagaagctg

tgatcttcaa

gaccattgtg

gccaaggaga

tctgtgctga

ccccaagcag

241

aagtgggttc

aggattccat

ggaccacctg

gacaagcaaa

cccaaactcc

gaagacttga

Proteína (Secuencia señal en negrita: 23 aa; MCP-1 madura: 76 aa) SEQ ID NO: 1

KVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP

KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT

De acuerdo con que es un miembro de la familia de las quimiocinas p, se ha mostrado que MCP-1 quimioatrae y activa monocitos in vitro a concentraciones subnanomolares. Se ha detectado elevada expresión de MCP-1 en una variedad de afecciones patológicas que implican la acumulación y activación de monocitos, que incluyen vahos estados de enfermedad inflamatoria y no inflamatoria, como artritis reumatoide, aterosclerosis, asma y reacciones de hipersensibilidad retardada.

Varios estudios han enfatizado en particular la función crucial de MCP-1 para el desarrollo de aterosclerosis (Gu, L. y col., (1998) Mol. Cell 2, 275-281; Gosling, J. y col., (1999) J Clin. Invest 13, 773-778); artritis reumatoide (Gong, J. H. y col., (1997) J Exp. Med 186, 131-137; Ogata, H. y col., (1997) J Pathol. 182, 16-114); pancreatitis (Bhatia, M. y col., (25) Am. J Physiol Gastrointest. Liver Physiol 288, G1259-G1265); enfermedad de Alzheimer (Yamamoto, M. y col., (25) Am. J Pathol. 166, 1475-1485); fibrosis pulmonar (Inoshima, I. y col., (24) Am. J Physiol Lung Cell Mol. Physiol 286, L138-L144); fibrosis renal (Wada, T. y col., (24) J Am. Soc. Nephrol. 15, 94-948) y rechazo del injerto (Saiura, A. y col., (24) Arterioscler. Thromb. Vasc. Biol. 24, 1886-189). Además, MCP-1 también podría desempeñar una función

en la gestosis (Katabuchi, H. y col., (23) Med Electron Mlcrosc. 36, 253-262), como factor paracrino en el desarrollo de tumores (Ohta, M. y col., (23) Int. J Oncol. 22, 773-778; Li, S. y col., (25) J Exp. Med 22, 617-624), dolor neuropátlco (Whlte, F. A. y col., (25) Proc. Nati. Acad. Sel. USA) y SIDA (Park, I. W., Wang, J. F. y Groopman, J. E. (21) Blood 97, 352-358; Coll, B. y col., (26) Cytokine 34, 51-55).

La forma madura de MCP-1 humana y de roedor se modifica postraduccionalmente por glutaminil ciclasa (QC) para poseer un residuo piroglutamilo (pGlu) del extremo N.

La glutaminil ciclasa (QC, EC 2.3.2.5) cataliza la delación intramolecular de residuos glutaminilo del extremo N en áddo piroglutámico (5-oxo-prolina, pGlu*) bajo liberadón de amoniaco y la delación intramolecular de residuos glutaminilo del extremo N en ácido piroglutámico bajo liberación de agua.

La modificación de pGlu del extremo N hace la proteína resistente contra la degradación del extremo N por aminopeptidasas, que es de importancia, ya que la potencia quimiotáctica de MCP-1 está mediada por su extremo N (Van Damme, J. y col., (1999) Chem Immunol 72, 42-56). El alargamiento o degradación artificial conduce a una pérdida de función aunque MCP-1 todavía se une a su receptor (CCR2) (Proost, P. y col., (1998), J Immunol 16, 434-441; Zhang, Y. J. y col., 1994, J Biol. Chem 269, 15918-15924; Masure, S. y col., 1995, J Interferon Cytokine Res. 15, 955-963; Hemmerich, S. y col., (1999) Biochemistry 38, 1313-1325).

Debido a la función importante de MCP-1 en varias condiciones de enfermedad, se requiere una potente herramienta de diagnóstico y una estrategia anti-MCP-1.

Como se ha mencionado anteriormente, pruebas convincentes señalan a una función de MCP-1 en enfermedad de Alzheimer (EA) (Xia, M.Q. y Hyman, B.T. (1999) J Neurovirol. 5, 32-41). Se ha observado la presencia de MCP-1 en placas seniles y en microglía reactiva, los macrófagos residenciales del SNC, en cerebros de pacientes que padecen EA (Ishizuka, K. y col., (1997) Psychiatry Clin. Neurosci. 51,135-138). La estimulación de monocitos y microglía con proteína amiloide-p (Ap) induce la secreción de quimiocinas in vitro (Meda, L. y col., (1996) J Immunol 157, 1213-1218; Szczepanik, A. M. y col., (21) J Neuroimmunol. 113, 49-62) y la infusión intracerebroventricular de Ap (1-42) en hipocampo murino aumenta significativamente MCP-1 in vivo. Además, los depósitos de Ap atraen y activan células de la microglía y las obligan a producir mediadores inflamatorios tales como MCP-1, que a su vez conducen a una retroalimentación para inducir adicionalmente quimiotaxis, activación y daño del tejido. En el sitio de depósito de Ap, la microglía activada también fagocita péptidos Ap, conduciendo a una amplificación de la activación (Rogers, J. y Lúe, L.F. (21) Neurochem. Int. 39, 333-34).

El examen de la expresión de quimiocinas en el modelo de ratón 3xTg para EA reveló que la inflamación neuronal precede a la formación de placas y la MCP-1 está regulada por incremento por un factor de 11. Además, la regulación por incremento de MCP-1 parece correlacionarse con la aparición de los primeros depósitos de Ap intracelulares (Janelsins, M.C. y col., (25) J Neuroinflammation. 2, 23). El cruce del modelo de ratón Tg2575... [Seguir leyendo]

 


Reivindicaciones:

1. Un anticuerpo que se une selectivamente al extremo amino que lleva piroglutamato de MCP-1 (MCP-1N1pE), en el que unión selectiva significa que no muestra ninguna reactividad cruzada con epitopos fuera del extremo amino que lleva piroglutamato de MCP-1 N1pE.

2. El anticuerpo de la reivindicación 1, en el que dicho anticuerpo es un anticuerpo monoclonal y/o quimérico.

3. El anticuerpo según una cualquiera de las reivindicaciones precedentes, en el que la parte variable de la cadena ligera de dicho anticuerpo está codificada por una secuencia de nucleótidos seleccionada de SEQ ID NO: 33, 37 y 41, o es una secuencia de aminoácidos seleccionada de SEQ ID NO: 34, 38 y 42

y/o

en el que la parte variable de la cadena pesada de dicho anticuerpo está codificada por una secuencia de nucleótidos seleccionada de SEQ ID NO: 35, 39 y 43, o es una secuencia de aminoácidos seleccionada de SEQ ID NO: 36, 4 y 44.

4. El anticuerpo según una cualquiera de las reivindicaciones precedentes, que se produce por células de hibridoma, en el que dichas células de hibridoma están seleccionadas del grupo que consiste en las células de hibridoma depositadas en la Deutsche Sammlung für Mikroorganismen und Zellkulturen GmbH, DSMZ, como DSM ACC 295, DSM ACC 296, DSM ACC 297 y DSM ACC 298.

5. El anticuerpo según una cualquiera de las reivindicaciones precedentes, anticuerpo que comprende una región variable de la cadena ligera codificada por una secuencia de ácido nucleico que es el 85 %, 86 %, 87 %, 88 %, 89 %, 9 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % o el 99 % idéntica a una secuencia seleccionada de SEQ ID NO: 33, 37 ó 41

y/o

anticuerpo que comprende una región variable de la cadena pesada codificada por una secuencia de ácido nucleico que

es el 85 %, 86 %, 87 %, 88 %, 89 %, 9 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % o el 99 % idéntica a una

secuencia seleccionada de SEQ ID NO: 35, 39 ó 43, o una parte funcional de la misma.

6. El anticuerpo según una cualquiera de las reivindicaciones precedentes, anticuerpo que comprende un dominio variable de la cadena ligera que comprende una secuencia de aminoácidos que es el 85 %, 86 %, 87 %, 88 %, 89 %, 9 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % o el 99 % idéntica a una secuencia seleccionada de SEQ ID NO: 34, 38 ó 42

y/o

anticuerpo que comprende un dominio variable de la cadena pesada que comprende una secuencia de aminoácidos que

es el 85 %, 86 %, 87 %, 88 %, 89 %, 9 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % o el 99 % idéntica a una

secuencia seleccionada de SEQ ID NO: 36, 4 ó 44.

7. El anticuerpo según una cualquiera de las reivindicaciones precedentes, en el que la parte variable de la cadena ligera de dicho anticuerpo comprende una secuencia de aminoácidos seleccionada de SEQ ID NO: 34, 38 y 42 y/o en el que la parte variable de la cadena pesada de dicho anticuerpo comprende una secuencia de aminoácidos seleccionada de SEQ ID NO: 36, 4 y 44, y en el que el anticuerpo ha sido alterado introduciendo al menos una, al menos dos, o al menos 3 o más sustituciones conservativas en al menos una de las secuencias de SEQ ID NO: 34, 36, 38, 4, 42 y 44, y en el que el anticuerpo mantiene su funcionalidad completa.

8. El anticuerpo según una cualquiera de las reivindicaciones precedentes, en el que dicho anticuerpo es un anticuerpo humanizado.

9. El anticuerpo según una cualquiera de las reivindicaciones precedentes, en el que dicho anticuerpo es un fragmento de anticuerpo, que retiene la alta afinidad por MCP-1 N1pE.

1. El anticuerpo según una cualquiera de las reivindicaciones precedentes, para su uso en la detección de MCP1 N1pE en un mamífero.

11. El anticuerpo según una cualquiera de las reivindicaciones precedentes, que es un diabody o un anticuerpo monocatenario que retiene la alta afinidad por MCP-1 N1pE.

12. El anticuerpo según una cualquiera de las reivindicaciones precedentes, que tiene las regiones determinantes de la complementariedad de los anticuerpos como se definen en la reivindicación 4.

13. El anticuerpo según una cualquiera de las reivindicaciones precedentes, que se marca y/o que se inmoviliza sobre una fase sólida.

14. Una línea celular de hibridoma seleccionada del grupo que consiste en DSM ACC 295, DSM ACC 296, DSM ACC 297 y DSM ACC 298, todas depositadas en la Deutsche Sammlung für Mikroorganismen und Zellkulturen GmbH, DSMZ.

15. Una composición, que comprende el anticuerpo de una cualquiera de las reivindicaciones 1 a 13.

16. Una composición farmacéutica que comprende el anticuerpo de una cualquiera de las reivindicaciones 1 a 13, en una cantidad terapéuticamente eficaz y, opcionalmente, otra sustancia biológicamente activa y/o un vehículo y/o un diluyente y/o un excipiente farmacéuticamente aceptable.

17. La composición farmacéutica de la reivindicación 17, en la que dicho compuesto biológicamente activo adicional está seleccionado de potenciadores de la transmisión de neutrones, fármacos psicoterapéuticos, inhibidores de la acetilcolina esterasa, bloqueantes de los canales de calcio, aminas biogénicas, tranquilizantes de benzodiazepina, potenciadores de la síntesis, almacenamiento o liberación de acetilcolina, agonistas del receptor postsináptico de acetilcolina, inhibidores de la monoamina oxidasa A o B, antagonistas del receptor de N-metil-D-aspartato glutamato, fármacos antiinflamatorios no esteroideos, antioxidantes, antagonistas de receptores serotonérgicos, antagonistas del receptor CCR2 y anticuerpos para MCP-1;

o

en la que dicho compuesto biológicamente activo adicional está seleccionado de compuestos eficaces contra el estrés oxidativo, compuestos antiapoptósicos, quelantes de metal, inhibidores de la reparación de ADN activadores de la a- secretasa, proteínas tau, neurotransmisor, interruptores de hojas (5, atrayentes para la eliminación de amiloide beta/agotamiento de componentes celulares, inhibidores de péptidos de amiloide beta truncados en el extremo N que incluyen amiloide beta 3-42 piroglutamado, inhibidores de glutaminil ciclasa, moléculas antiinflamatorias e inhibidores de la colinesterasa (ChEl), y otros fármacos que incluyen cualquier fármaco modificador de amiloide o de tau y suplementos nutritivos;

o

en la que dicho compuesto biológicamente activo adicional está seleccionado de inhibidores de PEP, LiCI, inhibidores de enzimas similares a DP IV o DP IV; inhibidores de la acetilcolinesterasa (AChE), potenciadores de PIMT, inhibidores de beta secretasas, inhibidores de gamma secretasas, inhibidores de endopeptidasa neutra, inhibidores de la fosfodiesterasa-4, inhibidores de TNFalfa, antagonistas de receptores muscarínicos M1, antagonistas del receptor NMDA, inhibidores del receptor slgma-1, antagonistas de la hlstamlna H3, agentes inmunomoduladores, agentes ¡nmunosupresores o un agente seleccionado de Antegren (natalizumab), Neurelan (fampridina-SR), Campath (alemtuzumab), IR 28, NBI 5788/MSP 771 (tiplimotida), paclitaxel, Anergix.MS (AG 284), SH636, Differin (CD 271, adapaleno), BAY 361677 (¡nterleucina-4), inhibidores de las metaloproteinasas de matriz (por ejemplo, BB 76163), ¡nterferón-tau (trofoblastlna) y SAIK-MS; anticuerpos para beta-amllolde, Inhibidores de la cisterna proteasa; antagonistas de MCP-1, inhibidores del depósito de proteína amiloide e Inhibidores de la síntesis de beta-amiloide.

18. El anticuerpo de una cualquiera de las reivindicaciones 1 a 13, o la composición de cualquiera de las reivindicaciones 15 a 17 para su uso en un método de diagnóstico o terapéutico.

19. El anticuerpo o la composición de la reivindicación 18 para su uso en el tratamiento, prevención o retraso de enfermedades y afecciones relacionadas con MCP-1 seleccionadas del grupo que consiste en enfermedades inflamatorias seleccionadas de

a. enfermedades neurodegenerativas, por ejemplo, deterioro cognitivo leve (DCL), enfermedad de Alzheimer, neurodegeneración en síndrome de Down, demencia familiar británica, demencia familiar danesa, esclerosis múltiple,

b. inflamaciones crónicas y agudas, por ejemplo, artritis reumatoide, aterosclerosis, reestenosis, pancreatitis,

c. fibrosis, por ejemplo, fibrosis pulmonar, fibrosis hepática, fibrosis renal,

d. cáncer, por ejemplo, proliferación de cáncer/hemangioendotelioma, carcinomas gástricos,

e. enfermedades metabólicas, por ejemplo, hipertensión,

f. y otras enfermedades inflamatorias, por ejemplo, dolor neuropático, rechazo del injerto/fallo del ¡njerto/vasculopatía del injerto, infecciones porVIH/SIDA, gestosis, esclerosis tuberosa.

2. Un método para detectar MCP-1 N1pE, que comprende la etapa de poner en contacto una muestra biológica que se supone que contiene dicho péptido con el anticuerpo de una cualquiera de las reivindicaciones 1 a 13, y detectar la unión

específica del anticuerpo a MCP-1 N1pE en la muestra.

21. Un método de diagnóstico in vitro o in situ para el diagnóstico de una enfermedad o afección relacionada con MCP-1, que comprende la detección de MCP-1 N1pE en una muestra biológica.

22. El método de la reivindicación 21, que comprende las siguientes etapas:

a. poner en contacto un anticuerpo de una cualquiera de las reivindicaciones 1 a 13, con una muestra, o una parte del cuerpo específica o área del cuerpo de un sujeto que se sospecha que está afectado con dicha afección o enfermedad, y

b. detectar la unión del anticuerpo a un péptido MCP-1 N1pE de la muestra.

23. El método de la reivindicación 21, que comprende detectar la unión inmunoespecífica de un anticuerpo de una cualquiera de las reivindicaciones 1 a 13, a un péptido MCP-1 N1pE en una muestra o in situ, que incluye las etapas de:

a. poner la muestra o una parte del cuerpo específica o área del cuerpo que se sospecha que contiene el péptido MCP-1 en contacto con el anticuerpo;

b. permitir que el anticuerpo se una al péptido MCP-1 N1pE para formar un complejo inmunológico;

c. detectar la formación del complejo inmunológico; y

d. correlacionar la presencia o ausencia del complejo inmunológico con la presencia o ausencia de péptido MCP-1 N1pE en la muestra o parte o área del cuerpo específica.

24. El método de cualquiera de las reivindicaciones 21 a 23, en el que dicha muestra biológica está seleccionada de una muestra de suero, líquido, líquido cefalorraquídeo (CSF) o líquido sinovial.

25. Uso del método de cualquiera de las reivindicaciones 21 a 24 para la detección y diagnóstico de enfermedades y afecciones relacionadas con MCP-1 seleccionadas del grupo que consiste en enfermedades inflamatorias seleccionadas de

a. enfermedades neurodegenerativas, por ejemplo, deterioro cognitivo leve (DCL), enfermedad de Alzheimer, neurodegeneración en síndrome de Down, demencia familiar británica, demencia familiar danesa, esclerosis múltiple,

b. inflamaciones crónicas y agudas, por ejemplo, artritis reumatoide, aterosclerosis, reestenosis, pancreatitis,

c. fibrosis, por ejemplo, fibrosis pulmonar, fibrosis hepática, fibrosis renal,

d. cáncer, por ejemplo, proliferación de cáncer/hemangioendotelioma, carcinomas gástricos,

e. enfermedades metabólicas, por ejemplo, hipertensión,

f. y otras enfermedades inflamatorias, por ejemplo, dolor neuropático, rechazo del injerto/fallo del injerto/vasculopatía del injerto, infecciones porVIH/SIDA, gestosis, esclerosis tuberosa.

26. Kit de diagnóstico, que comprende el anticuerpo como se define en una cualquiera de las reivindicaciones 1 a 13, e instrucciones para su uso, y - opcionalmente - (una) sustancia(s) biológicamente activa(s) adicional(es).

27. Un polinucleótido aislado que codifica la región variable de la cadena ligera de un anticuerpo monoclonal de la reivindicación 3, en el que dicho polinucleótido aislado comprende una secuencia de ácido nucleico seleccionada de SEQ ID NO: 33, 37 y 41;

o

un polinucleótido aislado que codifica la región variable de la cadena pesada de un anticuerpo monoclonal de la reivindicación 3, en el que dicho polinucleótido aislado comprende una secuencia de ácido nucleico seleccionada de SEQ ID NO: 35, 39 y 43;

o

un péptido aislado de la región variable de la cadena ligera de un anticuerpo monoclonal de la reivindicación 3, en el que dicho péptido aislado comprende una secuencia de aminoácidos seleccionada de SEQ ID NO: 34, 38 y 42;

o

un péptido aislado de la región variable de la cadena pesada de un anticuerpo monoclonal de la reivindicación 3, en el que dicho péptido aislado comprende una secuencia de aminoácidos seleccionada de SEQ ID NO: 36, 4 y 44.