Moléculas de virus TT reorganizadas para su uso en diagnóstico, prevención y tratamiento del cáncer y autoinmunidad.

Un poli(ácido nucleico) de virus TT reorganizado que comprende

A) una secuencia de nucleótidos que muestra al menos un 70 % de identidad respecto de una secuencia de nucleótidos que se selecciona entre las secuencias de nucleótidos mostradas en la figura 6 y un poli(ácido nucleico) que codifica un polipéptido que contiene un motivo de firma de una proteína de mamífero que está asociada con cáncer o una enfermedad autoinmunitaria,

en el que el poli(ácido nucleico) de virus TT reorganizado se selecciona entre el grupo de moléculas de μVTT que consiste en zpr4.20 mostrada en la figura 11B, zpr9.6 mostrada en la figura 12B y zpr12.24 mostrada en la figura 13B;

o

B)

(a) una secuencia de nucleótidos que se selecciona entre las secuencias de nucleótidos mostradas en la figura 6;

(b) una secuencia de nucleótidos que muestra al menos un 70 % de identidad respecto de una secuencia de nucleótidos de (a) y dicho poli(ácido nucleico) de virus TT reorganizado es capaz de replicarse de manera autónoma tras transfectarlo en células 293TT;

(c) una secuencia de nucleótidos que es el complemento de la secuencia de nucleótidos de (a) o (b); o

(d) una secuencia de nucleótidos que codifica una secuencia de aminoácidos seleccionada entre las secuencias de aminoácidos RVPKVSLHTA VKGQFGLGTG RAM, RVPKVSLHTA VKGQFGLGTG RAM, RVPEVSLHTA VKGQFGLGTG RAM, GAEGEFTHRS QGAIRARDWP GHG, GAEGEFTHRS QGAIRARDWP GYG, GAVGEFTHRS QGAIRARDWP GYG y GAGGEFTHRS QGAIRARDWP GYG mostradas en la figura 14 y dicho poli(ácido nucleico) de virus TT reorganizado es capaz de replicarse de manera autónoma tras su transfección en células 293TT, en el que dicha secuencia de nucleótidos de (a), (b), (c) o (d) está unida a un poli(ácido nucleico) que codifica un polipéptido que contiene un motivo de firma de una proteína de mamífero que está asociada con cáncer o una enfermedad autoinmunitaria mediante un enlace fosfodiéster, el motivo de firma es de al menos 10 aa y el grado de identidad de este motivo de firma respecto de un motivo correspondiente en una proteína de mamífero es de al menos el 80 %, pero no es idéntico a dicho motivo correspondiente, en el que dicho motivo correspondiente se selecciona entre el grupo que consiste en (1) opsina seleccionada entre las secuencias de aminoácido IYNSFHRGFALG y RLELQKRLPW LELNEKAVE;

(2) protamina 1 seleccionada entre las secuencias de aminoácidos

ARYRRRSRSRSRSRYGRRRRRSRSRRRRSRRRRR,

ARYRCCRSKSRSRCRRRRRRCRRRRRRCCRRRRR, y

ARYRCCRSPSRSRCRRRRRRFYRRRRRCHRRRRR;

(3) protamina 2 seleccionada entre las secuencias de aminoácidos

HTRRRRSCRRRRRRACRHRRHRRGCRRIRRRRRCR,

RRRSRSCRRRRRRSCRYRRRPRRGCRSRRRRRCRR,

HRRRRSCRRRRRHSCRHRRRHRRGCRRSRRRRRCR, y

RRRHRSCRRRRRRSCRHRRRHRRGCRTRRRRCRRY;

(4) galanina que tiene las secuencias de aminoácidos de

ATLGLGSPVKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELEPEDEARPGSFDRPL

SESNIVRTIIEFLSFLHLKEAGALDRLPGLPAAASSEDLERS;

(5) firma de repetición de tipo plexina/semaforina/integrina que tiene las secuencias de aminoácidos de RCSQVGVTSCSECLLARDPVGCGWCSSEGRCTRGERCDERRGSRQNWSSGPSSQCQ

(6) gastrina que tiene la secuencia de aminoácidos de VAGEDSDGCYVQLPRSR;

(7) colagenasa que tiene la secuencia de aminoácidos de

MSRLAELYLLGDSIKGRHDNLWLAAAEMLSYYAPEGKSELGIDICQAKLELAAKV1PYLYEC

SGPAAIRSQDLTDGQAASACDILRNKEKDFHQVKYTGKTPVADDGNTRVEVGVFVSEEDYKR

YSAFASKEVKAQFGRVTDNGGMYLEGNPSDAGNQVRFIAYEEAKLNADLSIGNLEHEYTHYL

DGRFDTYGTFSRNLEESHIVWWEEGFAEYVHYKQGGVPYQAAPELIGQGSKLYLSDVFTTTE

EGYAELFAGSHDTDRIYRWGYLAVRFMLETNHNRDYESLLYHSRYGNSFAFYAYLVKLLGYM

YNNEFGIWNNEFGIW;

(8) repetición de hélice de colágeno que tiene la secuencia de aminoácidos de

GPPGPPGPPGPPGPPGPPGPPGPAGAPGPPGPPGEPGPPGPPGPPGPPGPPGAPGAPGP;

(9) proteína específica masculina de esperma que tiene la secuencia de aminoácidos de VGGPCGPCGPCGGPCCGSCCSPCGGPCGPCGPCGPCGPCCGGCGPC GPCGPCCGTTEKYCGL;

(10) firma de metaloproteasa colagenasa microbiana (M9) que tiene la secuencia de aminoácidos de GLETLVEFLRAGYYVRFYN;

(11) firma de proteína MIC1 de micronema que tiene la secuencia de aminoácidos de TYISTKLDVAVGSCHK;

(12) firma de regulador autoinmunitario (AIRE) que tiene la secuencia de aminoácidos de DFWRVLFKDYNLERY;

(13) gliadina que tiene la secuencia de aminoácidos de PQAQGSVQPQQLPQFEEIRNL;

(14) firma de receptor Y2 de neuropéptido que tiene la secuencia de AFLSAFRCEQRLDAIHS;

(15) aerolisina que tiene la secuencia de aminoácidos de WDKRYIPGEVKWWDWNWTIQ;

(16) orexina que tiene la secuencia de aminoácidos de

MNLPSAKVSWAAYTLLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSC

RLYELLHGAGNHAAGILTLGKRRPGPPGLQGRLQRLLQASGNHAAGILT

MGRRAGAELEPRLCPGRRCLAAAASALAPRGRSRV;

(17) receptor GIP que tiene la secuencia de aminoácidos de PRLGPYlGDQTLTLWNQALAA;

(18) prion que tiene la secuencia de aminoácidos de SNGGSRYPGQGSPGGNRYPPQ;

(19) neurotensina que tiene la secuencia de aminoácidos de METSSPWPPRPSP;

(20) firma de la familia de receptor nuclear huérfano (receptor nuclear A4) que tiene la secuencia de aminoácidos de PVNLLNALVRAHVDSTP;

(21) firma de factor neurotrófico derivado de cerebro (BDN) que tiene la secuencia de aminoácidos de PLLFLLEEYKNYLDAAN;

(22) calcitonina que tiene la secuencia de aminoácidos de KCYDRMQQLPPYEGEGPY;

(23) receptor de tipo I de leucotrieno B4 seleccionada entre las secuencias de aminoácidos SRRLRVRRFHRRRRTGR y GRRLQARRFRRSRRTGR;

(24) autoantígeno 1 de síndrome de Sjögren/esclerodermia (Autoantígeno p27) que tiene la secuencia de aminoácidos de EISKKMAELLLKGATMLDEHCPKCGTPLFRLKDGKVFCPICE;

(25) vasopresina que tiene la secuencia de aminoácidos de RAGGRRRGRRTGSPSEGARV;

(26) firma de receptor 2 de hormona concentradora de melanina que tiene la secuencia de aminoácidos de LVQPFRLTRWRTRYKTIRIN;

(27) firma del receptor EP1 de prostanoide que tiene la secuencia de aminoácidos de ISLGPPGGWRQALLAGL;

(28) ciclincinasa que tiene la secuencia de aminoácidos de EWRSLGVQQSLGWVH;

(29) firma de receptor activado por proliferador de peroxisomas (receptor nuclear 1C) que tiene la secuencia de aminoácidos de KTETDASLHPLLQ;

(30) firma de receptor M1 muscarínico que tiene la secuencia de aminoácidos de KMPMVDPEAQAPTKQPPK;

(31) firma de receptor de tipo B2 de ácido gamma-aminobutírico (GABA) metabotrópico que tiene la secuencia de aminoácidos de LAPGAWGWARGAPRPPPSS;

(32) firma de arginina desaminasa que tiene la secuencia de aminoácidos de SELSRGRGGPRCMSMPLVR; (33) repetición de factor de crecimiento opioide que tiene la secuencia de aminoácidos de SPSETPGPRPAGPARDEPAE;

(34) firma de molécula de adhesión CD36 que tiene la secuencia de aminoácidos de WIFDVQNPDEVAKNSSKIKVKQR;

(35) firma de proteína protelipídica de mielina (PLP) que tiene la secuencia de aminoácidos de GVVLGAIIGGVLGVVLLLVLLLYLV; y

(36) chlamidiaom que tiene la secuencia de aminoácidos de CGSYVPSCSKPCG.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2011/003119.

Solicitante: DEUTSCHES KREBSFORSCHUNGSZENTRUM.

Nacionalidad solicitante: Alemania.

Dirección: IM NEUENHEIMER FELD 280 69120 HEIDELBERG ALEMANIA.

Inventor/es: ZUR HAUSEN, HARALD, DE VILLIERS, ETHEL-MICHELE.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • C07K14/005 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › de origen vírico.
  • C12Q1/70 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12Q PROCESOS DE MEDIDA, INVESTIGACION O ANALISIS EN LOS QUE INTERVIENEN ENZIMAS O MICROORGANISMOS (ensayos inmunológicos G01N 33/53 ); COMPOSICIONES O PAPELES REACTIVOS PARA ESTE FIN; PROCESOS PARA PREPARAR ESTAS COMPOSICIONES; PROCESOS DE CONTROL SENSIBLES A LAS CONDICIONES DEL MEDIO EN LOS PROCESOS MICROBIOLOGICOS O ENZIMOLOGICOS. › C12Q 1/00 Procesos de medida, investigación o análisis en los que intervienen enzimas o microorganismos (aparatos de medida, investigación o análisis con medios de medida o detección de las condiciones del medio, p. ej. contadores de colonias, C12M 1/34 ); Composiciones para este fin; Procesos para preparar estas composiciones. › en los que intervienen virus o bacteriófagos.

PDF original: ES-2685605_T3.pdf

 

  • Fb
  • Twitter
  • G+
  • 📞

Patentes similares o relacionadas:

Detección en tiempo real del virus de la gripe, del 28 de Noviembre de 2018, de Theranos IP Company, LLC: Un método de realización de un análisis de tendencia sobre la concentración de partículas del virus de la gripe en una pluralidad de muestras […]

Método y aparato para la detección de dianas usando virus unidos a electrodos, del 28 de Noviembre de 2018, de THE REGENTS OF THE UNIVERSITY OF CALIFORNIA: Ensamblaje de biosensor que comprende: un electrodo de oro electroconductor operativamente acoplado a un analizador de impendancia para […]

MÉTODOS Y KIT PARA DETECTAR VIRUS QUE PERTENECEN AL GÉNERO POTYVIRUS, del 1 de Noviembre de 2018, de CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS (CSIC): La presente invención se refiere, en general, a sondas de género, a métodos y a kits para detectar e identificar, en una sola etapa, todos los virus conocidos […]

Biomarcador de cáncer circulante y su uso, del 24 de Octubre de 2018, de National Taiwan University (50.0%): Un método para identificar una cantidad de uniones virus-hospedante en los ADNlc de un sujeto infectado por el virus de la hepatitis B que comprende: […]

Composiciones y procedimientos para la detección de virus 1 y 2 del herpes simple, del 17 de Octubre de 2018, de F. HOFFMANN-LA ROCHE AG: Un procedimiento para detectar la presencia o ausencia de un ácido nucleico de VHS-1 y/o VHS-2 en una muestra, comprendiendo el procedimiento: […]

Prueba de cribado para detectar la presencia de virus VPH oncogénicos, del 4 de Octubre de 2018, de Centrum Onkologii - Instytut Im. Marii Sklodowskiej-Curie: Método para determinar si una muestra resulta positiva en virus del papiloma humano (VPH) oncogénico, comprendiendo el método: combinar la muestra con […]

Método de cuantificación de las diferentes formas virales del ADN del VIH, del 26 de Septiembre de 2018, de CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (C.N.R.S.): Procedimiento de cuantificación de la forma lineal madura en 3' del genoma ADN del virus de la inmunodeficiencia humana 1 (VIH-1) en una muestra, en el que: (i) se […]

CÉLULA FELINA CAPAZ DE CULTIVARSE SIN PROTEÍNA DE ORIGEN ANIMAL, Y PROCEDIMIENTO PARA PRODUCIR UN VIRUS Y PROCEDIMIENTO PARA PRODUCIR UNA VACUNA USANDO EL MISMO, del 24 de Febrero de 2012, de KYORITSU SEIYAKU CORPORATION: Una cepa celular depositada con el Nº de Acceso FERM ABP-10594