La terapia anti-EMP2 reduce las células madre cancerosas.

Un anticuerpo para uso en la reducción de células madre cancerosas que expresan EMP2 en un paciente que tiene cáncer y que se ha identificado previamente que comprende células madre cancerosas que expresan EMP2 y uno o más marcadores seleccionados del grupo que consiste en CD44,

CD 133 ABCG2 y ALDH, en donde:

a) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos:

MAQVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAVYYCARDRRGRKSAGIDYWGQGTLVTVSS, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula**

b) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos:

MAQVQLVQSGGGLVQPGRSLRLSCAASGFSFSEYPMHWVRQAPGRGLESVAVISYDGEYQKYADSVKGRFTISRD DSKSTVYLQMNSLRPEDTAVYYCARTINNGMDVWGQGTTVT, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula**

c) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos:

MAQVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAVYYCARTVGATGAFDIWGQGTMVTVSSS, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula**

d) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos:

MAQVQLVQSGGGLVQPGRSLRLSCAASGFSFSEYPMHWVRQAPGRGLESVAVISYDGEYQKYADSVKGRFTISRD DSKSTVYLQMNSLRPEDTAVYYCARTINNGMDVWGQGTTVT, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula**

e) el anticuerpo compite para la unión a EMP2 con un anticuerpo que codifica a), b), c) o d);

f) el anticuerpo comparte 90% de identidad de aminoácidos con las regiones variables de las cadenas pesadas y ligeras de un anticuerpo de acuerdo con a), b), c) o d); o

g) el anticuerpo comprende secuencias de CDR idénticas a aquellas de un anticuerpo de acuerdo con a), b), c) o d).

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2013/031542.

Solicitante: THE REGENTS OF THE UNIVERSITY OF CALIFORNIA.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 1111 Franklin Street, 12th Floor Oakland, CA 94607-5200 ESTADOS UNIDOS DE AMERICA.

Inventor/es: BRAUN, JONATHAN, WADEHRA,MADHURI, GORDON,LYNN K, LAZAR,GARY S.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/00 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).
  • A61K39/395 A61K […] › A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53). › Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.
  • A61K45/06 A61K […] › A61K 45/00 Preparaciones medicinales que contienen ingredientes activos no previstos en los grupos A61K 31/00 - A61K 41/00. › Mezclas de ingredientes activos sin caracterización química, p. ej. compuestos antiflojísticos y para el corazón.
  • C07K16/00 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › Inmunoglobulinas, p. ej. anticuerpos mono o policlonales.
  • C07K16/18 C07K […] › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra materiales animales o humanos.
  • C07K16/22 C07K 16/00 […] › contra factores de crecimiento.
  • C07K16/28 C07K 16/00 […] › contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.
  • C07K16/30 C07K 16/00 […] › de células tumorales.
  • G01N33/574 SECCION G — FISICA.G01 METROLOGIA; ENSAYOS.G01N INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION DE SUS PROPIEDADES QUIMICAS O FISICAS (procedimientos de medida, de investigación o de análisis diferentes de los ensayos inmunológicos, en los que intervienen enzimas o microorganismos C12M, C12Q). › G01N 33/00 Investigación o análisis de materiales por métodos específicos no cubiertos por los grupos G01N 1/00 - G01N 31/00. › para el cáncer.

PDF original: ES-2689269_T3.pdf

 

  • Fb
  • Twitter
  • G+
  • 📞

Patentes similares o relacionadas:

Tratamiento para la caquexia, del 2 de Enero de 2019, de XBIOTECH, INC: Una composición farmacéutica para su uso en un método para tratar la caquexia asociada al cáncer en un sujeto humano, comprendiendo dicha composición farmacéutica […]

Epitopos de antígeno de superficie receptor de factor de crecimiento epidérmico y uso de los mismos, del 26 de Diciembre de 2018, de GREEN CROSS CORPORATION: Epítopo de un receptor de factor de crecimiento epidérmico (EGFR) que consiste en la secuencia de aminoácidos de RGDSFTH (SEQ ID NO: 2) o RGDSFTHTP (SEQ ID NO: 3).

Clones de ADN infeccioso quimérico de circovirus porcino y uso de los mismos, del 21 de Diciembre de 2018, de VIRGINIA TECH INTELLECTUAL PROPERTIES, INC.: Una vacuna para su uso en la protección de un lechón contra circovirus porcino (PCV) de tipo 2 o síndrome de desmedro multisistémico post-destete (PMWS) […]

Polipéptidos de interleucina-2 mutantes, del 21 de Diciembre de 2018, de ROCHE GLYCART AG: Un inmunoconjugado que comprende un polipéptido de IL-2 mutante y un resto de unión a antígeno, en el que dicho polipéptido de IL-2 mutante […]

NanobodiesTM mejorados para el tratamiento de trastornos mediados por agregación, del 19 de Diciembre de 2018, de ABLYNX N.V: Proteína o polipéptido, que comprende dos VHH, dominios VHH humanizados o dominios VH camelizados, en el que dichos VHH, dominios VHH humanizados […]

Anticuerpos específicos del Tgf-1 y métodos y usos de los mismos, del 19 de Diciembre de 2018, de Ludwig Institute for Cancer Research Limited: Una molécula de anticuerpo aislado o fragmento del mismo que reconoce el factor de crecimiento transformante beta 1 (TGF-ß1) humano y de ratón, no reacciona […]

Virus de la gripe porcina modificado por ingeniería genética y usos de los mismos, del 18 de Diciembre de 2018, de Icahn School of Medicine at Mount Sinai: Un virus de la gripe porcina atenuado, modificado por ingeniería genética, en donde el virus comprende un gen de NS1 de virus de la gripe porcina con una mutación que produce […]

Vehículo para distribuir un compuesto en una membrana mucosa y composiciones, procedimientos y sistemas relacionados, del 18 de Diciembre de 2018, de CALIFORNIA INSTITUTE OF TECHNOLOGY: Una composición bacteriana para su uso como medicamento, que comprende una vesícula de membrana externa formada por una membrana lipídica que encierra […]