Polipéptido de fusión serpina-dedo.

Polipéptido de fusión que comprende en dirección N-terminal hacia C-terminal el polipéptido serpina-dedo SEAAASTAVVIA (SEQ ID Nº:

07) o SEAAASMFLEAI (SEQ ID Nº: 11) fusionado con una inmunoglobulina u hormona o citocina o factor de crecimiento o ligando de receptores o agonista o antagonista o agente citotóxico o agente antivírico o agente de contraste o inhibidor de enzimas o activador de enzimas o modulador de la actividad enzimática, con un polipéptido conector de péptidos intercalado.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2011/065884.

Solicitante: F. HOFFMANN-LA ROCHE AG.

Nacionalidad solicitante: Suiza.

Dirección: GRENZACHERSTRASSE, 124 4070 BASEL SUIZA.

Inventor/es: KOPETZKI, ERHARD, ENGH,RICHARD, SCHLOTHAUER,Tilman.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • C07K14/16 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › VIH-1.
  • C07K14/81 C07K 14/00 […] › Inhibidores de proteasa.
  • C12N15/62 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K). › Secuencias de ADN que codifican proteínas de fusión.

PDF original: ES-2535704_T3.pdf

 


Fragmento de la descripción:

Polipéptido de fusión serpina-dedo.

La presente invención se refiere a polipéptidos de fusión formados por un polipéptido serpina-dedo y un segundo péptido, polipéptido o proteína, así como al uso de estos polipéptidos de fusión

Antecedentes de la presente invención

Los inhibidores de serina proteasas (serpinas) regulan múltiples vías fisiológicas, p.ej. de inflamación, coagulación, fibrinólisis, apoptosis y remodelación de la matriz extracelular. La serina proteasa parte el bucle reactivo de una serpina y la serina proteasa es inactivada por interrupción del sitio catalítico.

La alfa 1 -antitripsina es una glicoproteína de 52 kDa que está constituida por 394 aminoácidos y es sintetizada por hepatocitos, macrófagos y células epiteliales bronquiales. Las estructuras de los cristales muestran que la alfa 1- antitripsina consta de cinco láminas beta, nueve hélices alfa y un bucle reactivo desprotegido que comprende 14 restos y presenta una secuencia peptídica en forma de pseudosubstrato de la proteasa diana. La división del enlace reactivo escindióle, indicada como P1-P1, produce un cambio conformacional irreversible según el cual el resto N- terminal del bucle queda totalmente incorporado en medio de las láminas beta de alfa 1-antitripsina como hebra 4a (Schechter, I. y Berger, A., Biochem. Biophys. Res. Commun. 27 (1967) 157-162; Loebermann, H. y otros, J. Mol. Biol. 177 (1984) 531-557; Baumann, U. y otros, J. Mol. Biol. 218 (1991) 595-66; Baumann, U. y otros, J. Mol. Biol. 226 (1992) 127-1218; Mourey, L. y otros, Biochim. 72 (199) 599-68; Mourey, L. y otros, J. Mol. Biol. 232 (1993) 223-241).

Tras la división proteolítica por su proteasa diana se separa P1 Met y P1 Ser y el bucle inactivo del sitio reactivo se inserta como hebra 4a en la lámina beta antiparalela A. Un péptido con la secuencia de aminoácidos de la hebra 4a, restos 345-358 de alfa 1-antitripsina humana Thr-Glu-Ala-Ala-Gly-Ala-Met-Phe-Leu-Glu-Ala-lle-Val-Met, se junta con alfa 1-antitripsina intacta y forma un complejo estequ¡ométrico con propiedades similares a la alfa 1-antitripsina dividida (Schulze, A.J. y otros, Eur. J. Biochem. 194 (199) 51-56).

En la patente WO 97/24453 se presentan polipéptidos quiméricos de superficie viral, específicos del receptor, para la incorporación e internalización de virus y partículas en células diana. En la patente EP 147 761 se presenta un complejo de enlace covalente del inhibidor de proteasa alfa 1-antitripsina con un polímero soluble en agua. En la patente US 26/4867 se presentan inhibidores de la actividad de serina proteasa y su empleo en métodos y composiciones para el tratamiento de infecciones bacterianas.

Schulze, A.J. y otros reseñan la transición estructural de la alfa 1-antitripsina mediante un péptido de secuencia similar a la hebra S4A (Eur. J. Biochem. 194 (199) 51-56). En Anti-infective agents in medicinal chemistry [Agentes antiinfecciosos en química médica], Bentham Science publishers, Hilversum (NL), 7 (28) 126-133, Congote, L.F. presenta agentes anti-VIH multifuncionales basados en secuencias de aminoácidos existentes en péptidos C- terminales de serpina. Qi, Z. y otros (J. Biol. Chem. 283 (28) 3376-3384) revelan péptidos anti-VIH diseñados racionalmente, que contienen dominios multifuncionales como sondas moleculares para el estudio del mecanismo de acción de la primera y segunda generaciones de inhibidores de fusión de VIH. En la patente WO 1/51673 se informa de métodos y composiciones para la inhibición de incidencias relacionadas con la fusión de membrana, incluyendo la transmisión de VIH. En la patente WO 2/6317 se revelan quimeras de fijación de integrinas. En la patente EP 355 95 se revelan fragmentos y fracciones de heparina con acción anti-VIH. En las patentes WO /5234 y US 6,849,65 se presentan inhibidores de la actividad de serina proteasa y métodos y composiciones para el tratamiento de infecciones víricas.

Resumen de la presente invención

Se ha encontrado que un polipéptido serpina-dedo debe tener un mínimo número de restos de aminoácidos para permitir una asociación suficientemente rápida con una serpina. Además se ha comprobado que es ventajoso que el resto de aminoácido en posición 2 de los aminoácidos del polipéptido serpina-dedo (contando a partir del N terminal del polipéptido serpina-dedo) sea de ácido glutámico.

Aquí se presenta un polipéptido de fusión serpina-dedo que comprende

- un polipéptido serpina-dedo y

- otro polipéptido,

de manera que el polipéptido adicional puede ser cualquier polipéptido que ejerza una acción biológica tal como inhibición, activación, fijación o mareaje.

En una forma de ejecución el polipéptido de fusión serpina-dedo comprende adicionalmente al menos uno de los siguientes componentes

- un polipéptido conectar de péptidos,

- un sitio de división por proteasa,

- un marcador.

La secuencia de aminoácidos del polipéptido serpina-dedo se puede elegir entre AGAMFLEAIVM (SEQ ID N°: 1), AAGAMFLEAIVM (SEQ ID N°: 2), TEAAGAMFLEAIVM (SEQ ID N°: 3), AGAMFLEAIVM (SEQ ID N°: 4), TEAAGAMFFEAIPM (SEQ ID N°: 5), TAVVIA (SEQ ID N°: 6), SEAAASTAVVIA (SEQ ID N°: 7), TEAAGATAVVIA (SEQ ID N°: 8), T D AAGAT AVV IA (SEQ ID N°: 9), SDAAGAMFLEAI (SEQ ID N°: 1) y SEAAASMFLEAI (SEQ ID N°: 11). En una forma de ejecución la secuencia de aminoácidos del polipéptido serpina-dedo se elige entre SEAAASTAVVIA (SEQ ID N°: 7) y SEAAASMFLEAI (SEQ ID N°: 11).

En una forma de ejecución la secuencia de aminoácidos del polipéptido conector de péptidos es GGSGG (SEQ ID N°: 12) o SGGGGSGGGGSGGGGT (SEQ ID N°: 52) o STT (SEQ ID N°: 75).

En una forma de ejecución el resto de aminoácido en posición 2 de los aminoácidos del polipéptido serpina-dedo (contando a partir del N terminal del polipéptido serpina-dedo) es de ácido glutámico.

En una forma de ejecución el polipéptido serpina-dedo consta de 8 a 14 restos de aminoácidos, en una forma de ejecución de 1 a 14 restos de aminoácidos y en una forma de ejecución de 11 a 13 restos de aminoácidos.

En una forma de ejecución el polipéptido adicional se elige entre inmunoglobullnas, fragmentos de ¡nmunoglobulinas, hormonas, citocinas, factores de crecimiento, ligandos de receptores, agonistas de receptores, antagonistas de receptores, ligandos de enzimas, agonistas de enzimas, antagonistas de enzimas, agentes citotóxicos, agentes antivíricos, agentes de contraste y moduladores de la actividad enzimática.

Aquí se presenta, en un aspecto, un polipéptido de fusión que comprende en dirección N- hacia C-terminal un polipéptido serpina-dedo fusionado con un polipéptido biológicamente activo, opcionalmente con un polipéptido conector de péptidos intercalado.

En una forma de ejecución el polipéptido biológicamente activo es un agente antivírico.

En una forma de ejecución el agente antivírico es un polipéptido inhibidor de la fusión de VIH. En una forma de ejecución la secuencia de aminoácidos del polipéptido inhibidor de la fusión de VIH es MTWMEWDREINNYTSLIHS- LIEESQNQQEKNEQELLELDKWASLWNWF.

Otro aspecto presentado aquí es un complejo proteico de un polipéptido de fusión serpina-dedo como el descrito en esta exposición y una serpina o un fragmento de la misma, con el polipéptido de fusión incorporado como hebra 4a en medio de la lámina beta A de la serpina.

Aquí se presenta una composición farmacéutica que contiene el polipéptido de fusión serpina-dedo descrito en esta exposición o el complejo proteico aquí revelado y opcionalmente un vehículo farmacéuticamente aceptable.

Otro aspecto presentado aquí es el polipéptido de fusión serpina-dedo descrito en esta exposición o el complejo proteico ofrecido para usarlo como medicamento.

Otro aspecto presentado aquí es el polipéptido de fusión serpina-dedo descrito en esta exposición o el complejo proteico ofrecido para usarlo en el tratamiento de una infección vírica.

El polipéptido de fusión serpina-dedo o el complejo proteico aquí descritos se presentan para usarlos en la inhibición de la fusión de membrana célula-célula o de la infección de una célula por un virus.

Se ofrece el uso del polipéptido de fusión serpina-dedo o del complejo proteico aquí descritos en la elaboración de un medicamento.

Aquí se presenta un método para tratar un sujeto afectado por una infección vírica, que consiste en administrarle una cantidad efectiva del polipéptido de fusión serpina-dedo o del complejo proteico aquí descritos.

Aquí se presenta un método para inhibir la fusión de membrana célula-célula o un método para inhibir la infección vírica de una célula por un... [Seguir leyendo]

 


Reivindicaciones:

1. Polipéptido de fusión que comprende en dirección N-terminal hacia C-terminal el polipéptido serpina-dedo SEAAASTAVVIA (SEQ ID N°: 7) o SEAAASMFLEAI (SEQ ID N°: 11) fusionado con una ¡nmunoglobulina u hormona o citocina o factor de crecimiento o ligando de receptores o agonista o antagonista o agente citotóxico o agente antivírico o agente de contraste o inhibidor de enzimas o activador de enzimas o modulador de la actividad enzimática, con un polipéptido conectar de péptidos intercalado.

2. Polipéptido de fusión según la reivindicación 1, caracterizado porque el polipéptido biológicamente activo es un polipéptido inhibidor de la fusión de VIH.

3. Polipéptido de fusión según la reivindicación 1, caracterizado porque el polipéptido biológicamente activo es una ¡nmunoglobulina o un conjugado de ¡nmunoglobulina.

4. Polipéptido de fusión según cualquiera de las reivindicaciones anteriores, caracterizado porque comprende un polipéptido conectar de péptidos entre el polipéptido serpina-dedo y el polipéptido biológicamente activo, con la secuencia de aminoácidos GGSGG (SEQ ID N°: 12).

5. Polipéptido de fusión según cualquiera de las reivindicaciones 2 y 4, caracterizado porque la secuencia de aminoácidos del polipéptido inhibidor de la fusión de VIH es MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE- LDKWASLWNWF.

6. Complejo proteico de un polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5 con alfa 1- antitripsina.

7. Polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5 o complejo proteico según la reivindicación 6, para usarlo como medicamento.

8. Polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5 o complejo proteico según la reivindicación 6, para usarlo en el tratamiento de una Infección vírica.

9. Polipéptido de fusión según cualquiera de las reivindicaciones 2 hasta 5 o complejo proteico según la reivindicación 6, para usarlo en el tratamiento de una infección por VIH.

1. Uso de alfa 1-antitripsina o antitrombina para elaborar un complejo proteico con un polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5.


 

Patentes similares o relacionadas:

Cadena ligera de enteroquinasa modificada, del 22 de Julio de 2020, de NOVO NORDISK A/S: Un análogo de la cadena ligera de la enteroquinasa bovina que comprende una secuencia de aminoácidos establecida en la SEQ ID NO: 1, en donde dicho análogo comprende […]

Detección de interacciones proteína a proteína, del 15 de Julio de 2020, de THE GOVERNING COUNCIL OF THE UNIVERSITY OF TORONTO: Un método para medir cuantitativamente la fuerza y la afinidad de una interacción entre una primera proteína de membrana o parte de la misma y una […]

Métodos y composiciones para ingeniería genómica, del 3 de Junio de 2020, de Sangamo Therapeutics, Inc: Una pareja de nucleasas de dedo de zinc (ZFN) que comprende una ZFN izquierda y una ZFN derecha, comprendiendo cada ZFN un dominio de escisión […]

Métodos y composiciones para escisión dirigida y recombinación, del 20 de Mayo de 2020, de Sangamo Therapeutics, Inc: Un método in vitro para la escisión selectiva de un gen HLA clase I, un gen HLA que codifica una proteína de clase 1 del Complejo de Histocompatibilidad Mayor (MHC) […]

Antígenos de coagulasa estafilocócica y métodos para su uso, del 13 de Mayo de 2020, de UNIVERSITY OF CHICAGO: Una composición inmunógena que comprende al menos dos dominios 1-2 de coagulasa estafilocócica diferentes, en donde cada uno de los al menos dos dominios […]

Reconocimiento de unión a diana celular mediante un agente bioactivo usando transferencia de energía de resonancia de bioluminiscencia intracelular, del 6 de Mayo de 2020, de PROMEGA CORPORATION: Un sistema de ensayo que comprende: (a) una biblioteca de agentes bioactivos, cada uno de los cuales está fijado a un fluoróforo; (b) una diana celular fusionada a […]

Utilización diagnóstica de un polipéptido de fusión que comprende una proteína vírica y un enzima MGMT, del 15 de Abril de 2020, de INSTITUT PASTEUR: Utilización in vitro de un polipéptido de fusión que comprende una proteína vírica y i) el enzima 6-metilguanina-ADN-metiltransferasa (MGMT, EC 2.1.1.63) o un homólogo […]

Etiqueta de epítopo y método de detección, captura y/o purificación de polipéptidos etiquetados, del 15 de Abril de 2020, de ChromoTek GmbH: Péptido epítopo aislado que tiene de 12 a 25 aminoácidos, en donde la secuencia de aminoácidos comprende una secuencia según se define en SEQ ID NO: 32 (X1X2RX4X5AX7SX9WX11X12), […]

Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .