ClyA no hemolítica para la excreción de proteínas.

Un método para producir una proteína de fusión, que comprende:



(a) transformar una población de bacterias con un vector de expresión que codifica una proteína de fusión, en el que dicha proteína de fusión comprende una proteína de interés unida al extremo carboxi-terminal de una proteína de exportación, en el que dicha proteína de exportación es una proteína citolisina A (ClyA) de Salmonella enterica serovar Typhi (S. Typhi) que tiene una actividad hemolítica sustancialmente reducida en comparación con la proteína ClyA de SEQ ID NO:2, teniendo dicha proteína de exportación la secuencia de aminoácidos indicada en SEQ ID NO:2 y teniendo una mutación seleccionada del grupo que consiste en una mutación S195N, una mutación I198N, una mutación A199D, una mutación E204K y una mutación C285W, y

(b) cultivar las bacterias transformadas de (a) en un medio de cultivo bajo condiciones en las que dicha proteína de fusión se expresa y se exporta hacia el medio de cultivo.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2009/045972.

Solicitante: UNIVERSITY OF MARYLAND, BALTIMORE.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 620 West Lexington Street, 4th Floor Baltimore, MD 21201 ESTADOS UNIDOS DE AMERICA.

Inventor/es: GALEN,JAMES,E, CHEN,YUANSHA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • C07K19/00 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › Péptidos híbridos (Inmoglobulinas híbridas compuestas   solamente de inmoglobulinas C07K 16/46).
  • C12N15/64 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K). › Métodos generales para la preparación del vector, para su introducción en la célula o para la selección del huésped que contiene el vector.

PDF original: ES-2473605_T3.pdf

 


Fragmento de la descripción:

ClyA no hemolítica para la excreción de proteínas Apoyo estatal

El sistema de exportación de proteínas definido en la presente se desarrolló gracias a la subvención nº MARCE US4 A1057168 de the National Institutes of Health. La administración de EEUU tiene ciertos derechos sobre esta invención.

Antecedentes de la invención Campo de la invención La siguiente descripción se refiere al uso de un sistema de exportación de proteínas. El sistema descrito proporciona métodos eficaces y composiciones útiles para la producción de proteínas recombinantes.

Descripción de la técnica relacionada Los sistemas de expresión de proteínas han utilizado durante mucho tiempo vectores de expresión o plásmidos de expresión de alto número de copias para intentar aumentar los rendimientos de proteínas recombinantes de interés. Los plásmidos de expresión de alto número de copias y las proteínas de interés que codifican pueden ejercer un efecto negativo sobre la aptitud de un hospedante que contiene un plásmido de expresión. La carga notable a la que se someten las células hospedantes procariotas que portan plásmidos de múltiples copias es el resultado acumulado de una cascada metabólica activada por dos procesos: 1) la replicación y el mantenimiento de los plásmidos de expresión, y 2) la transcripción y la traducción de las diversas funciones codificadas por el plásmido que incluye el gen de interés. Estos mecanismos pueden explicar la observación de que las bacterias que portan plásmidos crecen con más lentitud que las bacterias que no tienen plásmidos. Esta carga también puede explicar la observación de que la velocidad de crecimiento disminuye a medida que aumenta el número de copias.

A medida que se expresa el gen de interés, disminuye la velocidad de crecimiento de la célula hospedante recombinante. La disminución en la velocidad de crecimiento puede activar la inducción de diversas proteasas celulares que pueden degradar la proteína producida de modo recombinante presente en el citoplasma de la célula hospedante. Por tanto, una menor velocidad de crecimiento es la consecuencia inevitable de la carga metabólica que, a su vez, es el resultado acumulado de una serie de perturbaciones fisiológicas. Debido a que esta reducción en la velocidad de crecimiento crea una presión selectiva sobre la pérdida de los plásmidos residentes en ausencia de selección, puede producirse una pérdida significativa de los plásmidos de expresión desde la célula hospedante que porta un vector de expresión después de la transformación de la célula hospedante.

Las células hospedantes con menores velocidades de crecimiento pueden expulsar espontáneamente un plásmido de expresión para eliminar de la célula hospedante una carga metabólica innecesaria y permitir que las células hospedantes sin plásmidos sobrepasen con rapidez a la población de células hospedantes que portan plásmidos. Se supone que este desplazamiento en la expresión de proteínas dentro de una población de células hospedantes reduciría la producción de proteínas.

Por consiguiente, sería deseable preparar un sistema de expresión de proteínas que optimice la expresión de proteínas del vector de expresión, mientras que al mismo tiempo minimice la carga metabólica sobre la célula hospedante generada por el vector de expresión.

El documento WO 2002/083890 describe un sistema de exportación de proteínas para producir proteínas recombinantes desde una célula hospedante. En una realización preferida, el sistema de exportación de proteínas utiliza la maquinaria de exportación de proteínas endógena de la bacteria hospedante en la que se introduce el vector del sistema de exportación de proteínas. Este documento describe la secuencia de la proteína ClyA de Salmonella enterica serovar Typhi (S. Typhi) . Este documento describe una proteína de fusión que comprende al menos una porción de la proteína ClyA de S. Typhi y otra proteína de interés.

Galen et al. (2004) , "Adaptation of the Endogenous Salmonella enterica Serovar Typhi clyA-Encoded Hemolysin for Antigen Export Enhances the Immunogenicity of Anthrax Protective Antigen Domain 4 Expressed by the Attenuated Live-Vector Vaccine Strain CVD 9098-htrA", Infection and Immunity, 72 (12) :7096-7106, describen proteínas de fusión de ClyA de S. Typhi condensadas con el dominio 4 de protección del antígeno del ántrax, y su uso para la vacunación.

Sumario de la invención El material descrito se refiere al uso de una proteína de exportación para facilitar la exportación de una proteína de fusión hacia el exterior de una célula hospedante. Una realización descrita proporciona un método para expresar un gen en una célula bacteriana, que comprende proporcionar un vector de expresión a una población de células hospedantes bacterianas no transformadas, en el que el vector de expresión comprende un módulo de expresión que comprende una secuencia codificadora de una proteína de exportación condensada genéticamente con una secuencia codificadora de una proteína de interés, expresar el módulo de expresión de modo que se produce una proteína de fusión de la proteína de exportación::proteína de interés y se exporta o se transporta hacia el medio de cultivo.

Otra realización descrita se refiere a un método para inducir una respuesta inmunológica en un animal, que comprende proporcionar a un animal una población de células hospedantes bacterianas transformadas con un vector de expresión que comprende un módulo de expresión que comprende una secuencia codificadora de una proteína de exportación condensada genéticamente con una secuencia codificadora de una proteína de interés, expresar el módulo de expresión de modo que se produce una proteína de fusión de la proteína de exportación::proteína de interés y se exporta o se transporta hacia el animal, e inducir una respuesta inmunológica en el animal contra la proteína de fusión.

Otra realización descrita se refiere a un sistema para expresar una proteína de interés que comprende: un vector de expresión que comprende un módulo de expresión, en el que el módulo de expresión comprende una secuencia codificadora de una proteína de exportación condensada genéticamente con una secuencia codificadora de una proteína de interés, una célula hospedante transformada con el vector de expresión, y un entorno de cultivo para la célula hospedante transformada, en el que el módulo de expresión expresa una proteína de fusión de la proteína de exportación::proteína de interés, que se exporta hacia el exterior de la célula hospedante transformada.

En un aspecto, la presente invención proporciona un método para producir una proteína de fusión, que comprende (a) transformar una población de bacterias con un vector de expresión que codifica una proteína de fusión, en el que la proteína de fusión comprende una proteína de interés unida al extremo carboxi terminal de una proteína de exportación, en el que dicha proteína de exportación es una proteína citolisina A (ClyA) de Salmonella enterica serovar Typhi (S. Typhi) que tiene una actividad hemolítica sustancialmente reducida en comparación con la proteína ClyA de SEQ ID NO:2, teniendo dicha proteína de exportación la secuencia de aminoácidos indicada en SEQ ID NO:2 y teniendo una mutación seleccionada del grupo que consiste en una mutación S195N, una mutación I198N, una mutación A199D, una mutación E204K y una mutación C285W, y (b) cultivar las bacterias transformadas de (a) en un medio de cultivo bajo condiciones en las que dicha proteína de fusión se expresa y se exporta hacia el medio de cultivo. La bacteria puede ser Salmonella spp., Shigella spp., Vibrio spp., o E. coli. Los ejemplos no limitantes de realizaciones incluyen, pero no se limitan a S. Typhi, tal como S. Typhi CVD 908 que tiene una mutación htrA, E. coli, tal como E. coli enterotoxigénica (ETEC) o E. coli enteroagregativa (EAEC) , Vibrio cholerae, y Shigella flexneri 2a. Además, la proteína de interés es un antígeno. El método puede incluir la etapa adicional de recolectar la proteína de fusión del medio de cultivo.

En otras realizaciones igualmente preferidas de este método, la proteína citolisina A (ClyA) de S. Typhi tiene la secuencia de aminoácidos indicada en SEQ ID NO:2 y una mutación individual seleccionada del grupo que consiste en una mutación S195N, una mutación I198N, una mutación A199D, una mutación E204K y una mutación C285W; una mutación doble I198N, C285W; y una mutación triple I198N, A199D, E204K. La proteína citolisina A (ClyA) de S. Typhi también puede tener la secuencia de aminoácidos indicada en SEQ ID NO:2 y una mutación C285W, así como una mutación adicional... [Seguir leyendo]

 


Reivindicaciones:

1. Un método para producir una proteína de fusión, que comprende:

(a) transformar una población de bacterias con un vector de expresión que codifica una proteína de fusión, en el que dicha proteína de fusión comprende una proteína de interés unida al extremo carboxi-terminal de una proteína de exportación, en el que dicha proteína de exportación es una proteína citolisina A (ClyA) de Salmonella enterica serovar Typhi (S. Typhi) que tiene una actividad hemolítica sustancialmente reducida en comparación con la proteína ClyA de SEQ ID NO:2, teniendo dicha proteína de exportación la secuencia de aminoácidos indicada en SEQ ID NO:2 y teniendo una mutación seleccionada del grupo que consiste en una mutación S195N, una mutación I198N, una mutación A199D, una mutación E204K y una mutación C285W, y

(b) cultivar las bacterias transformadas de (a) en un medio de cultivo bajo condiciones en las que dicha proteína de fusión se expresa y se exporta hacia el medio de cultivo.

2. Una población de bacterias para su uso para inducir una respuesta inmunológica contra una proteína de fusión en un sujeto, en la que dicha población de bacterias produce y exporta una proteína de fusión en una cantidad suficiente para inducir una respuesta inmunológica en dicho sujeto contra dicha proteína de fusión, en la que dichas bacterias comprenden un vector de expresión que codifica dicha proteína de fusión, en la que dicha proteína de fusión comprende una proteína de interés unida al extremo carboxi-terminal de una proteína de exportación, y en la que dicha proteína de exportación es una proteína citolisina A (ClyA) de Salmonella enterica serovar Typhi (S. Typhi) que tiene una actividad hemolítica sustancialmente reducida en comparación con la proteína ClyA de SEQ ID NO:2, teniendo dicha proteína de exportación la secuencia de aminoácidos indicada en SEQ ID NO:2 y teniendo una mutación seleccionada del grupo que consiste en una mutación S195N, una mutación I198N, una mutación A199D, una mutación E204K y una mutación C285W.

3. Un vector de expresión que comprende un módulo de expresión, en el que el módulo de expresión comprende una secuencia codificadora de una proteína de exportación unida a una secuencia codificadora de una proteína de interés en una disposición 5' a 3', en el que dicha proteína de exportación es una proteína citolisina A (ClyA) de Salmonella enterica serovar Typhi (S. Typhi) que tiene una actividad hemolítica sustancialmente reducida en comparación con la proteína ClyA de SEQ ID NO:2, teniendo dicha proteína de exportación la secuencia de aminoácidos indicada en SEQ ID NO:2 y teniendo una mutación seleccionada del grupo que consiste en una mutación S195N, una mutación I198N, una mutación A199D, una mutación E204K y una mutación C285W.

4. El método de la reivindicación 1 o la población de bacterias para su uso para inducir una respuesta inmunológica de la reivindicación 2, en el que dicha bacteria se selecciona del grupo que consiste en Salmonella spp., Vibrio spp. Escherichia spp. y Shigella spp.

5. El método o la población de bacterias para su uso para inducir una respuesta inmunológica de la reivindicación 4, en el que dicha bacteria se selecciona del grupo que consiste en S. Typhi, E. coli, E. coli enterotoxigénica (ETEC) , E. coli enteroagregativa (EAEC) y Shigella flexneri 2a.

6. El método, la población de bacterias para su uso para inducir una respuesta inmunológica o el vector de expresión de una cualquiera de las reivindicaciones 1 a 5, en el que la proteína de interés es un antígeno.

7. El método de una cualquiera de las reivindicaciones 1, 4, 5 y 6, que comprende además recoger dicha proteína de fusión desde el medio de cultivo.

8. El método, la población de bacterias para su uso para inducir una respuesta inmunológica o el vector de expresión de una cualquiera de las reivindicaciones 1 a 7, en el que la proteína citolisina A (ClyA) de S. Typhi tiene la secuencia de aminoácidos indicada en SEQ ID NO:2 y tiene una mutación C285W, y otra mutación seleccionada del grupo que consiste en una mutación I198N, una mutación A199D, y una mutación E204K.

9. El método, la población de bacterias para su uso para inducir una respuesta inmunológica o el vector de expresión de una cualquiera de las reivindicaciones 1 a 7, en el que la proteína citolisina A (ClyA) de S. Typhi tiene la secuencia de aminoácidos indicada en SEQ ID NO:2 y tiene una mutación I198N, una mutación A199D, y una mutación E204K.

10. El método, la población de bacterias para su uso para inducir una respuesta inmunológica o el vector de expresión de una cualquiera de las reivindicaciones 1 a 8, en el que la proteína citolisina A (ClyA) de S. Typhi tiene la secuencia de aminoácidos indicada en SEQ ID NO:2 y tiene una mutación I198N y una mutación C285W.

11. El método, la población de bacterias para su uso para inducir una respuesta inmunológica o el vector de expresión de una cualquiera de las reivindicaciones 1 a 7, en el que la proteína citolisina A (ClyA) de S. Typhi tiene la secuencia de aminoácidos indicada en SEQ ID NO:2, y en el que la proteína de interés es la proteína de la toxina del ántrax PA83.

12. La población de bacterias para su uso para para inducir una respuesta inmunológica de una cualquiera de las reivindicaciones 2, 4 a 6 y 8 a 11, en la que dicho sujeto es un animal.

13. La población de bacterias para su uso para para inducir una respuesta inmunológica de la reivindicación 12, en el que dicho sujeto es un ser humano.

Figura 15

Grupo Régimen de inmunizacióna Porcentaje de ratonesb con seroconversión y (GMT) c

Cebador 1 Cebador 2 Refuerzo Dia 42 Día 49 Día 56 Día 70

1 CV.

90. htrA CV.

90. htrA PA 0 (16) 20 (104) 100 (9.807) 100 (223.230)

2 CV.

90. htrA (pSEC91-83) CV.

90. htrA (pSEC91-83) PA 80 (479) 100 (84.498) 100 (297.860) 100 (967.681)

3 CV.

90. htrA (pS-CPA83-I198N) ) CV.

90. htrA (pS-CPA83-I198N) PA 10 (31) 100 (15.223) 100 (120.477) 100 (670.169)

4 CV.

90. htrA (pS-CPA83-C285W) CV.

90. htrA (pS-CPA83-C285W) PA 0 (15) 100 (14.079) 100 (137.606) 100 (607.847)

5 CV.

90. htrA (pS-CPA83-DM) CV.

90. htrA (pS-CPA83-DM) PA 0 (21) 100 (4.258) 100 (85.290) 100 (699.931)

6 PBS PBS PBS 0 (21) 0 (21) 0 (21) 0 (28)

aLos animales recibieron las inmunizaciones primarias en los días 0 y 14 y las inmunizaciones de refuerzo en el día 42.

b Representa el porcentaje de ratones que desarrollan titulaciones de IgG anti-PA séricas recíprocas después de la vacunación. Los sueros se ensayaron a partir de dos diluciones en serie en dos veces comenzando en 1:50. c Representa la media geométrica de las titulaciones anti-PA séricas (GMT) , en unidades ELISA (EU) .


 

Patentes similares o relacionadas:

Proteínas multifuncionales que comprenden MHC de clase I multivalente unida por disulfuro, del 20 de Febrero de 2019, de F. HOFFMANN-LA ROCHE AG: Una proteína multifuncional multivalente unida por disulfuro, caracterizada por que comprende - uno o dos dominios presentadores de antígeno, […]

Métodos y composiciones para la proteína IL-10 de citomegalovirus, del 6 de Febrero de 2019, de UAB RESEARCH FOUNDATION: Una proteína IL-10 de citomegalovirus seleccionada de: (i) una proteína IL-10 de citomegalovirus como se representa en la SEQ ID NO:3, o que consiste […]

Transportador de vacuna, del 5 de Febrero de 2019, de BIOMAY AG: Una molécula hipoalergénica derivada de PhI p 5 y que consiste en la secuencia de aminoácidos GAASNKAFAEGLSGEPKGAAESSSKAALTSK, ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGK o TVATAPEVKYTVFETALKKAITAMSEAQKAAK.

Antígenos recombinantes del VSR, del 23 de Enero de 2019, de ID BIOMEDICAL CORPORATION OF QUEBEC: Un antígeno del virus sincitial respiratorio recombinante (VSR) que se ensambla en un trímero, que comprende un polipéptido de la proteína F soluble que comprende […]

Péptidos derivados de ERK y usos de los mismos, del 16 de Enero de 2019, de YEDA RESEARCH AND DEVELOPMENT CO. LTD.: Un péptido aislado que no tiene más de 20 aminoácidos de longitud que comprende una secuencia tal como se recoge en SEQ ID NO: 4, en donde X1 y X2 son cualquier aminoácido, […]

Receptores de antígenos quiméricos anti-variante III de receptor de factor de crecimiento epidérmico y uso de los mismos para el tratamiento de cáncer, del 11 de Enero de 2019, de The United States Of America, As Represented By The Secretary, Department Of Health And Human Services (100.0%): Receptor de antígeno quimérico (CAR) que comprende un dominio de unión a antígeno contra la variante III de receptor de factor de crecimiento epidérmico, un dominio […]

Grupos dirigidos al receptor del complemento 2 (cr2) mejorados, del 9 de Enero de 2019, de The Regents of the University of Colorado, a body corporate: Una composición soluble capaz de la administración dirigida de un modulador del complemento a sitios de activación del sistema del complemento que comprenden una construcción, […]

Polipéptidos de interleucina-2 mutantes, del 21 de Diciembre de 2018, de ROCHE GLYCART AG: Un inmunoconjugado que comprende un polipéptido de IL-2 mutante y un resto de unión a antígeno, en el que dicho polipéptido de IL-2 mutante […]

Otras patentes de UNIVERSITY OF MARYLAND, BALTIMORE