Péptidos derivados de neuropéptidos y.

Un péptido derivado del neuropéptido Y (NPY) (SEQ ID NO: 22), donde dicho péptido se selecciona del grupo que consiste en:

un péptido que consiste en 32 residuos de aminoácidos contiguos que tienen la secuencia KPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY4-35, SEQ ID NO: 2)

o KPDNPGEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 27 residuos de aminoácidos contiguos que tienen la secuencia GEDAPAEDMARYYSALRHYINLITRQR (NPY9-35, SEQ ID NO: 7) o GEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 26 residuos de aminoácidos contiguos que tienen la secuencia EDAPAEDMARYYSALRHYINLITRQR (NPY10-35, SEQ ID NO: 8)

o EDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 25 residuos de aminoácidos contiguos que tienen la secuencia DAPAEDMARYYSALRHYINLITRQR (NPY11-35, SEQ ID NO: 9)

o DAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 23 residuos de aminoácidos contiguos que tienen la secuencia PAEDMARYYSALRHYINLITRQR (NPY13-35, SEQ ID NO: 11)

o PAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 22 residuos de aminoácidos contiguos que tienen la secuencia 20 AEDMARYYSALRHYINLITRQR (NPY14-35, SEQ ID NO: 12)

o AEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 21 residuos de aminoácidos contiguos que tienen la secuencia EDMARYYSALRHYINLITRQR (NPY15-35, SEQ ID NO: 13)

o EDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 20 residuos de aminoácidos contiguos que tienen la secuencia DMARYYSALRHYINLITRQR (NPY16-35, SEQ ID NO: 14)

o DMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 19 residuos de aminoácidos contiguos que tienen la secuencia MARYYSALRHYINLITRQR (NPY17-35, SEQ ID NO: 15)

o MARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 18 residuos de aminoácidos contiguos que tienen la secuencia ARYYSALRHYINLITRQR (NPY18-35, SEQ ID NO: 16)

o ARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 17 residuos de aminoácidos contiguos que tienen la secuencia RYYSALRHYINLITRQR 35 (NPY19-35, SEQ ID NO: 17)

o RYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

un péptido que consiste en 16 residuos de aminoácidos contiguos que tienen la secuencia YYSALRHYINLITRQR (NPY20-35, SEQ ID NO: 18) o YYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos, y

un péptido que consiste en 15 residuos de aminoácidos contiguos que tienen la secuencia YSALRHYINLITRQR (NPY21-35, SEQ ID NO: 19) o YSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos,

donde dicho péptido estimula la proliferación de neuritas,

y donde péptido no se une y / o no activa los receptores NPY afines Y1, Y2 y / o Y5.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/DK2014/050086.

Solicitante: UNIVERSITY OF COPENHAGEN.

Inventor/es: BEREZIN,VLADIMIR, BOCK,ELISABETH, WOLDBYE,DAVID PAUL DRUCKER, GØTZSCHE,CASPER RENE, KLEMP,KRISTIAN.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/04 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00). › Péptidos que tienen hasta 20 aminoácidos en una secuencia totalmente determinada; Sus derivados (gastrinas A61K 38/16, somatostatinas A61K 38/31, melanotropinas A61K 38/34).
  • A61K38/22 A61K 38/00 […] › Hormonas (derivados de pro-opiomelanocortina, pro-encefalina o pro-dinorfina A61K 38/33, p. ej. corticotropina A61K 38/35).
  • C07K14/575 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › Hormonas.

PDF original: ES-2729970_T3.pdf

 

Patentes similares o relacionadas:

Dispositivo de inhalación, del 27 de Marzo de 2019, de Xellia Pharmaceuticals ApS: Un dispositivo de administración pulmonar, que comprende una unidad de boquilla de pulverización y un cartucho que contiene una solución […]

Péptidos de la familia RFamida y métodos relacionados, del 22 de Febrero de 2019, de THE REGENTS OF THE UNIVERSITY OF MICHIGAN: Un péptido aislado que comprende la secuencia de aminoácidos: L-P-L-A-Famida en donde, dicho péptido modula la función cardíaca en un vertebrado; […]

Tratamiento, del 19 de Febrero de 2019, de Yaqrit Limited: Un antagonista del receptor de tipo Toll 4 (TLR4) para su uso en un método de tratamiento o prevención de disfunción renal en un individuo […]

Compuestos de balanol para su uso en el tratamiento de dolor, del 17 de Enero de 2019, de THE TRUSTEES OF COLUMBIA UNIVERSITY IN THE CITY OF NEW YORK: Uso de un agente que tiene la fórmula I**Fórmula** en la que n es 1, 2 o 3; Z es N o CH; en la que X representa uno de los siguientes grupos funcionales:**Fórmula** […]

Composiciones y procedimientos de transfección de polinucleótidos, del 12 de Diciembre de 2018, de WASHINGTON UNIVERSITY: Una composición farmacéutica que comprende un complejo péptido-polinucleótido, comprendiendo el complejo péptido-polinucleótido una relación molar de péptido:polinucleótido […]

Uso de hepcidina para preparar un medicamento para tratar trastornos de la homeostasis del hierro, del 7 de Diciembre de 2018, de INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM): Polipéptido para su uso en un procedimiento de tratamiento para reducir la sobrecarga de hierro, en el que el polipéptido comprende una secuencia de 20 aminoácidos que tiene: […]

Agentes para mejorar la administración de fármacos, del 21 de Noviembre de 2018, de THE UNIVERSITY OF BATH: Un péptido que comprende una secuencia de acuerdo con la Fórmula 2 X5-X6-X7-X8 Fórmula 2 (Id. de Sec. nº: 2) en la que: X5 es cualquier […]

PROCEDIMIENTO DE EVITAR CONDENSACIÓN DE VIRUS: CÉLULAS INHIBIENDO LA FUNCIÓN DE LA REGIÓN DE INICIACIÓN DE CONDENSACIÓN EN LOS VIRUS ARN QUE TIENEN PROTEÍNAS DE ENVOLTURA FUSOGÉNICAS DE MEMBRANA DE CLASE I, del 25 de Enero de 2012, de THE ADMINISTRATORS OF THE TULANE EDUCATIONAL FUND Autoimmune Technologies, LLC: Un péptido aislado para usar en tratar gripe, constituido el péptido por una secuencia de SEC ID N.º: 4 o un segmento de 8 a 40 aminoácidos contiguos […]

Otras patentes de la CIP C07K14/575