GONADOTROPINA MONOCATENARIA.

LA PRESENTE INVENCION SE REFIERE A LOS METODOS PARA POTENCIAR LA FERTILIDAD REDUCIENDO LAS ACTIVIDADES Y/O LOS NIVELES DE HORMONAS GLUCOPROTEICAS CIRCULANTES CON ACTIVIDAD LUTEOTROPICA (LH).

LAS MOLECULAS DE LA INVENCION SON ANTICUERPOS U OTROS AGENTES DE UNION QUE REDUCEN LAS ACTIVIDADES BIOLOGICAS DE LA LH. LA PRESENTE INVENCION SE REFIERE TAMBIEN A METODOS NUEVOS PARA DISEÑAR Y/O SELECCIONAR ANTICUERPOS CONTRA PARTES ESPECIFICAS DE PROTEINAS COMO LA LH Y LA GONADOTROPINA CORIONICA HUMANA (HCG) CON EL FIN DE PERMITIR LA REDUCCION DE SUS ACTIVIDADES BIOLOGICAS HASTA LOS GRADOS DESEADOS. LA PRESENTE INVENCION SE REFIERE TAMBIEN A LA PREPARACION DE SUBUNIDADES AISLADAS DE LAS GONADOTROPINAS Y DE ANTAGONISTAS DE GONADOTROPINAS PARA SER UTILIZADOS EN LA ESTIMULACION E INHIBICION DE LA FERTILIDAD Y PARA EL CONTROL DE LA HIPERESTIMULACION OVARICA. EN UNA REALIZACION PREFERENTE, LA PRESENTE INVENCION SE REFIERE A UN METODO DE ESTIMULACION DE LA FERTILIDAD EN MAMIFEROS BASADO EN LA REDUCCION DE LA ACTIVIDAD DE HORMONAS GLUCOPROTEICAS CON ACTIVIDAD LUTEINIZANTE PRESENTES EN LA CIRCULACION Y A LA ESTIMULACION DE LA PRODUCCION DE HORMONA FOLICULOESTIMULANTE MEDIANTE LA ADMINISTRACION A MAMIFEROS DE UNA CANTIDAD EFECTIVA DEL AGENTE DE UNION QUE SE UNE A LA HORMONA LUTEINIZANTE.

Tipo: Resumen de patente/invención.

Solicitante: WASHINGTON UNIVERSITY.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 1 BROOKINGS DRIVE, ST. LOUIS, MO 63130.

Fecha de Publicación: .

Fecha Concesión Europea: 28 de Diciembre de 2005.

Clasificación Internacional de Patentes:

  • C07K14/59 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › Hormona estimulante del folículo (FSH); Gonadotropinas coriónicas, p. ej. HCG; Hormona luteinizante (LH); Hormona estimulante del tiroides (TSH).
  • C07K19/00 C07K […] › Péptidos híbridos (Inmoglobulinas híbridas compuestas   solamente de inmoglobulinas C07K 16/46).

Patentes similares o relacionadas:

Complejos multiespecíficos multivalentes y monovalentes y sus usos, del 13 de Marzo de 2019, de Zyngenia, Inc: Un dominio de reconocimiento modular (MRD), en donde el MRD es un péptido capaz de unirse a ANG2 y en donde el MRD comprende la secuencia de SEQ ID […]

Generación de complejos polipeptídicos multifuncionales y multivalentes mediante el dominio de trimerización del colágeno XVIII, del 22 de Febrero de 2019, de Leadartis, S.L: Un complejo polipeptídico trimérico que comprende tres polipéptidos monómeros, en donde (i) cada uno de dichos polipéptidos monómeros comprende un elemento estructural […]

Proteínas multifuncionales que comprenden MHC de clase I multivalente unida por disulfuro, del 20 de Febrero de 2019, de F. HOFFMANN-LA ROCHE AG: Una proteína multifuncional multivalente unida por disulfuro, caracterizada por que comprende - uno o dos dominios presentadores de antígeno, […]

Métodos y composiciones para la proteína IL-10 de citomegalovirus, del 6 de Febrero de 2019, de UAB RESEARCH FOUNDATION: Una proteína IL-10 de citomegalovirus seleccionada de: (i) una proteína IL-10 de citomegalovirus como se representa en la SEQ ID NO:3, o que consiste […]

Transportador de vacuna, del 5 de Febrero de 2019, de BIOMAY AG: Una molécula hipoalergénica derivada de PhI p 5 y que consiste en la secuencia de aminoácidos GAASNKAFAEGLSGEPKGAAESSSKAALTSK, ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGK o TVATAPEVKYTVFETALKKAITAMSEAQKAAK.

Antígenos recombinantes del VSR, del 23 de Enero de 2019, de ID BIOMEDICAL CORPORATION OF QUEBEC: Un antígeno del virus sincitial respiratorio recombinante (VSR) que se ensambla en un trímero, que comprende un polipéptido de la proteína F soluble que comprende […]

Péptidos derivados de ERK y usos de los mismos, del 16 de Enero de 2019, de YEDA RESEARCH AND DEVELOPMENT CO. LTD.: Un péptido aislado que no tiene más de 20 aminoácidos de longitud que comprende una secuencia tal como se recoge en SEQ ID NO: 4, en donde X1 y X2 son cualquier aminoácido, […]

Receptores de antígenos quiméricos anti-variante III de receptor de factor de crecimiento epidérmico y uso de los mismos para el tratamiento de cáncer, del 11 de Enero de 2019, de The United States Of America, As Represented By The Secretary, Department Of Health And Human Services (100.0%): Receptor de antígeno quimérico (CAR) que comprende un dominio de unión a antígeno contra la variante III de receptor de factor de crecimiento epidérmico, un dominio […]

Otras patentes de WASHINGTON UNIVERSITY