CIP 2015 : C07K 16/40 : contra enzimas.

CIP2015CC07C07KC07K 16/00C07K 16/40[1] › contra enzimas.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C07 QUIMICA ORGANICA.

C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales.

C07K 16/40 · contra enzimas.

CIP2015: Invenciones publicadas en esta sección.

Métodos de generación de anticuerpos contra metaloenzimas.

(02/11/2018). Solicitante/s: YEDA RESEARCH AND DEVELOPMENT CO. LTD.. Inventor/es: SAGI,Irit, SELA-PASWELL,NETTA, GROSSMAN,MORAN.

Un método de generación de un anticuerpo que inhibe MMP-7, donde el método comprende la inmunización de un sujeto no humano con: (i) [2-(2-aminoetilcarbamoil)etoximetil]tris[2-(N-(3-imidazol-1-ilpropil))etoximetil]metano; y (ii) MMP-7, generando así el anticuerpo que inhibe la MMP-7, donde el método no es un método de tratamiento, donde el anticuerpo comprende una región de reconocimiento de antígeno que se une a un sitio catalítico de MMP-7 y [2-(2- aminoetilcarbamoil)etoximetil]tris[2-(N-(3-imidazol-1-ilpropil))etoximetil]metano.

PDF original: ES-2688457_T3.pdf

Anticuerpos anti-HtrA1 y procedimientos de uso.

(30/10/2018). Solicitante/s: F. HOFFMANN-LA ROCHE AG. Inventor/es: KIRCHHOFER, DANIEL, LIANG,Wei-ching, WU,Yan, VAN LOOKEREN CAMPAGNE,MENNO, MORAN,PAUL M, LIPARI,MICHAEL TERRY, KATSCHKE,JR. KENNETH J, STAWICKI,SCOTT.

Un anticuerpo monoclonal aislado que se une a HtrA1 e inhibe su actividad serina proteasa para uno o mas sustratos para HtrA1, en el que el anticuerpo comprende una secuencia de VH que comprende la SEQ ID NO: 32 y una secuencia de VL que comprende la SEQ ID NO: 31.

PDF original: ES-2687951_T3.pdf

Proteínas de unión a calicreína plasmática.

(30/10/2018) Un anticuerpo que se une a la forma activa de calicreína plasmática humana y no se une a precalicreína humana, y en el que el anticuerpo se selecciona del grupo que consiste en (i) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVS S y secuencia VL de DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (ii) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGS LRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGI TVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRTGIPRRDAFDIWG QGTMVTVSSASTKGPSVFPLAPSSKS y una secuencia VL de QDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPNLLIYKASTLESG VPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (iii) un anticuerpo que comprende una secuencia…

Inhibidores de factor XII para el tratamiento de trastornos inflamatorios neurológicos.

(23/10/2018). Solicitante/s: CSL BEHRING GMBH. Inventor/es: NOLTE,MARC, KLEINSCHNITZ,CHRISTOPH, MEUTH,SVEN, GOEBEL,KERSTIN, MCKENZIE,BRENT.

Inhibidor de factor XII para su uso en la prevención y/o el tratamiento y/o la mejora de una enfermedad inflamatoria neurológica, en el que el inhibidor de FXII comprende (i) la secuencia de polipéptidos de infestina-5 4 no mutante (SEQ ID NO: 2), o una variante de la misma, en la que la variante comprende (a) los aminoácidos 2-13 del extremo N de SEQ ID NO: 2; y al menos una y hasta cinco mutaciones de aminoácido fuera de dichos aminoácidos de extremo N que dan como resultado diferencias de la secuencia de infestina-4 no mutante; y/o (b) seis restos de cisteína conservados; y homología de al menos 70 % con la secuencia de infestina-4 no mutante; o (ii) un anticuerpo anti-FXII o fragmento de unión al antígeno del mismo, en el que el anticuerpo se une a FXII e inhibe su actividad y/o activación.

PDF original: ES-2687018_T3.pdf

Métodos para tratar afecciones asociadas con la activación de complemento dependiente de MASP-2.

(26/09/2018). Solicitante/s: UNIVERSITY OF LEICESTER. Inventor/es: DEMOPULOS, GREGORY, A., SCHWAEBLE,HANS-WILHELM, DUDLER,TOM.

Un anticuerpo monoclonal contra MASP-2 o un fragmento del mismo que inhibe la activación de la vía de complemento de la lectina dependiente de MASP-2 para su uso en el tratamiento de un sujeto que padece hemoglobinuria paroxística nocturna (HPN), en donde dicho anticuerpo contra MASP-2 o fragmento del mismo se une específicamente a una parte de la SEQ ID NO: 6 e inhibe de manera selectiva la activación de la vía de complemento de la lectina dependiente de MASP-2 mientras que deja intacta la vía de activación de complemento clásica dependiente de C1q.

PDF original: ES-2683307_T3.pdf

Células de acoplamiento para inmunoterapia.

(17/09/2018). Solicitante/s: BAYLOR COLLEGE OF MEDICINE. Inventor/es: GOTTSCHALK,STEPHEN M. G, SONG,XIAO-TONG, IWAHORI,KOTA, VELASQUEZ,MIREYA PAULINA, ABBOTT,STERWART.

Una célula que comprende un vector de polinucleótido que codifica una molécula bipartita que comprende un dominio de activación que se une a una o más moléculas de superficie celular y un dominio de reconocimiento de antígeno que se une a EphA2 y/o CD19, en donde el dominio de activación es un fragmento variable de cadena única (scFv) que reconoce CD3 y en donde la célula es un linfocito T o una célula NK.

PDF original: ES-2681948_T3.pdf

Anticuerpos monoclonales humanos para quinasa-1 de tipo receptor de activina (ALK-1).

(14/09/2018). Solicitante/s: AMGEN FREMONT INC.. Inventor/es: KELLERMANN,SIRID-AIMEE, WANG,JIANYING, JIANG,XIN, BEDIAN,VAHE, NORTH,MICHAEL AIDAN, AMUNDSON,KARIN KRISTINA, BELOUSKI,SHELLEY SIMS, HU-LOWE,DANA DAN, KARLICEK,SHANNON MARIE, THOMSON,JAMES ARTHUR, WICKMAN,GRANT RAYMOND, ZHANG,JINGCHUAN.

Uso de un anticuerpo monoclonal neutralizante anti ALK-1, o parte de unión a antígeno del mismo, para la fabricación de un medicamente para el tratamiento de cáncer hepatobiliar, carcinoma de células renales, cáncer colorrectal, mesotelioma o cáncer de la uretra en un ser humano que lo necesite, en el que dicho anticuerpo o parte de unión a antígeno del mismo comprende las secuencias de aminoácidos de CDR1, CDR2 y CDR3 de los dominios variables de cadena pesada y ligera, respectivamente, de SEQ ID NO: 6 y 8; SEQ ID NO: 14 y 16; SEQ ID NO: 18 y 20; SEQ ID NO: 26 y 28; SEQ ID NO: 30 y 32; SEQ ID NO: 38 y 40; SEQ ID NO: 46 y 48; SEQ ID NO: 50 y 52; SEQ ID NO: 54 y 56; SEQ ID NO: 58 y 60; SEQ ID NO: 62 y 64; SEQ ID NO: 66 y 68; o SEQ ID NO: 70 y 72.

PDF original: ES-2681656_T3.pdf

Moléculas de unión a antígeno con afinidad de unión a receptores Fc y función efectora incrementadas.

(09/05/2018). Solicitante/s: ROCHE GLYCART AG. Inventor/es: UMANA,PABLO, BRUNKER,PETER, FERRARA KOLLER,CLAUDIA, SUTER,TOBIAS, PUNTENER,URSULA, MOSSNER,EKKEHARD.

Anticuerpo anti-CD20 de tipo II humanizado que comprende: (a) una región variable de cadena pesada seleccionada de entre SEC ID nº 62, SEC ID nº 64, SEC ID nº 66, SEC ID nº 68, SEC ID nº 70 y SEC ID nº 72, y (b) la región variable de cadena ligera de KV1 de SEC ID nº 76.

PDF original: ES-2672640_T3.pdf

Métodos y composiciones para tratar y detectar enfermedades mediadas por la SOD1 mal plegada.

(02/05/2018). Solicitante/s: ProMIS Neurosciences Inc. Inventor/es: CASHMAN,NEIL, CHAKRABARTTY,AVIJIT, RAKHIT,RISHI, OSTERMANN,JOACHIM BERNHARD.

Una composición para su uso en el tratamiento de la esclerosis lateral amiotrófica (ELA), comprendiendo dicha composición un vehículo farmacéuticamente aceptable y un agente seleccionado de: un anticuerpo exógeno aislado o fragmento del mismo que se une selectivamente a un epítopo específico de la enfermedad (DSE) seleccionado de: i) DLGKGGNEESTKTGNAGS (SEQ ID NO:2) o CDLGKGGNEESTKTGNAGS (SEQ ID NO: 11), ii) CIKGLTEGLHGF (SEQ ID NO:14) o IKGLTEGLHGF (SEQ ID NO:5); y iii) GLHGFHVH (SEQ ID NO:7); y/o iv) un epítopo específico de la enfermedad de uno cualquiera de i), ii) o iii) que comprende uno o más aminoácidos oxidados o nitrados; y/o un inmunógeno que comprende un péptido que consiste en la secuencia de aminoácidos de una cualquiera de SEQ ID NO: 2, 5, 7, 11, 14, comprendiendo dicho péptido hasta 50 restos de SOD1, o un inmunógeno de que comprende uno o más aminoácidos oxidados o nitrados.

PDF original: ES-2680020_T3.pdf

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(25/04/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Anticuerpo aislado, o uno de sus fragmentos divalentes de unión a c-Met, caracterizado por que el anticuerpo comprende una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente las secuencias de aminoácidos SEC ID nº 56, 57 y 58; y una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente las secuencias de aminoácidos SEC ID nº 59, 60 y 61.

PDF original: ES-2678495_T3.pdf

Anticuerpos humanos contra PCSK9 para su uso en métodos de tratamiento de grupos de sujetos particulares.

(21/03/2018) Composición farmacéutica que comprende un anticuerpo o un fragmento de unión al antígeno del mismo que se une específicamente a proproteína convertasa subtilisina/kexina tipo 9 humana (PCSK9h) junto con un excipiente o vehículo farmacéuticamente aceptable para su uso en el tratamiento de una enfermedad o afección, en la que la expresión o actividad de PCSK9 causa un impacto, en un paciente humano, en la que el anticuerpo o fragmento de unión al antígeno del mismo comprende las tres CDRs de la cadena pesada expuestas en SEQ ID NO: 76, 78, y 80 y las tres CDRs de la cadena ligera expuestas en SEQ ID NO: 84, 86, y 88, en la que la composición farmacéutica está comprendida en una forma de dosificación…

Métodos para tratar afecciones asociadas con la activación del complemento dependiente de MASP-2.

(28/02/2018). Solicitante/s: OMEROS CORPORATION. Inventor/es: PARENT, JAMES B., TEDFORD, CLARK, E., FUJITA,TEIZO, SCHWAEBLE,HANS-WILHELM, STOVER,CORDULA M.

Un agente inhibidor de MASP-2 que inhibe selectivamente la activación del complemento dependiente de MASP-2 sin inhibir sustancialmente la activación del complemento dependiente de C1q que es un anticuerpo anti-MASP-2 o un fragmento del mismo que se une específicamente a una parte de la secuencia SEQ ID NO: 6, para su uso en la inhibición de la restenosis que sigue a un procedimiento seleccionado del grupo que consiste en colocación de un stent, aterectomía rotacional y/o angioplastia coronaria transluminal percutánea (PTCA).

PDF original: ES-2671052_T3.pdf

Composiciones y métodos para inhibir la MASP-1 y/o la MASP-3 para el tratamiento de la hemoglobinuria nocturna paroxísmica.

(28/02/2018). Solicitante/s: OMEROS CORPORATION. Inventor/es: DEMOPULOS, GREGORY, A., SCHWAEBLE,HANS-WILHELM.

Una composición que comprende una cantidad de un agente inhibidor de la MASP-3, eficaz para inhibir la activación del complemento dependiente de la MASP-3, para usar en el tratamiento de un sujeto que padece de hemoglobinuria paroxística nocturna (HPN), en la que dicho agente inhibidor de la MASP-3 es un anticuerpo monoclonal de la MASP-3 o un fragmento del mismo que se une específicamente a una porción de la MASP-3humana (ID. DE SEC. N.º 8).

PDF original: ES-2670668_T3.pdf

Péptidos TOPK y vacunas que los incluyen.

(10/01/2018). Solicitante/s: ONCOTHERAPY SCIENCE, INC.. Inventor/es: NAKAMURA, YUSUKE, TSUNODA,TAKUYA, OSAWA,RYUJI, YOSHIMURA,SACHIKO, WATANABE TOMOHISA, NAKAYAMA,GAKU.

Un péptido aislado de menos de 15 aminoácidos seleccionado del grupo que consiste en (a) y (b) a continuación: (a) un péptido aislado que tiene inducibilidad de linfocitos T citotóxicos (CTL) que comprende una secuencia de aminoácidos seleccionada del grupo que consiste en SEQ ID NO: 42, 45, 47, 50, 51, 53, 54, 62, 63, 64, 66, 71, 72 y 76, y (b) un péptido aislado que comprende una secuencia de aminoácidos seleccionada del grupo que consiste en SEQ ID NO: 42, 45, 47, 50, 51, 53, 54, 62, 63, 64, 66, 71, 72 y 76, en la que 1 o 2 aminoácido(s) están sustituidos, insertados y/o añadidos, en la que el péptido tiene inducibilidad de CTL.

PDF original: ES-2665576_T3.pdf

Moléculas biespecíficas de unión a antígeno activadoras de linfocitos T.

(13/12/2017) Una molécula biespecífica de unión a antígeno activadora de linfocitos T que comprende un primer y un segundo resto de unión a antígeno, siendo uno de ellos una molécula Fab capaz de unirse específicamente a un antígeno activador de linfocitos T y siendo el otro de ellos una molécula Fab capaz de unirse específicamente a un antígeno de célula diana, y un dominio Fc compuesto por una primera y una segunda subunidad capaces de crear una asociación estable; en la que el primer resto de unión a antígeno es una molécula Fab entrecruzada en la que las regiones variables o constantes de la cadena ligera Fab y la cadena pesada Fab están intercambiadas; en la que el primer y el segundo resto de unión a antígeno están fusionados entre sí, opcionalmente a través de conector peptídico; y en la que la molécula…

Anticuerpos anti-FAP y procedimientos de uso.

(08/11/2017). Solicitante/s: ROCHE GLYCART AG. Inventor/es: KLEIN, CHRISTIAN, DR., UMANA,PABLO, MOESSNER,EKKEHARD, HOSSE,RALF, BACAC,MARINA, FREIMOSER-GRUNDSCHOBER,ANNE, NICOLINI,VALERIA G.

Un anticuerpo que se une específicamente a la proteína de activación de fibroblastos (FAP), en el que dicho anticuerpo comprende una región variable de la cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 267 y una región variable de la cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 265.

PDF original: ES-2655616_T3.pdf

Enzimas que tienen actividad de alfa amilasa y métodos de uso de las mismas.

(01/11/2017) Un ácido nucleico aislado, sintético o recombinante que comprende: (A) (i) una secuencia que codifica un polipéptido que tiene actividad de alfa amilasa, en la que dicha secuencia tiene por lo menos 90%, 95%, 96%, 97%, 98%, 99% o 100% de identidad de secuencia con la secuencia de la SEQ ID NO: 53, o fragmentos enzimáticamente activos de las mismas, en donde el fragmento tiene actividad de alfa amilasa, o (ii) la secuencia de (i), en la que la identidad de la secuencia se determina por análisis con un algoritmo de comparación de secuencias, o se determina mediante inspección visual, o (iii) la secuencia de (ii), en la que el algoritmo de comparación de secuencias…

Anticuerpos de dominio simple dirigidos contra factor de necrosis tumoral-alfa y usos para los mismos.

(01/11/2017). Solicitante/s: ABLYNX N.V. Inventor/es: LAUWEREYS, MARC, SILENCE,KAREN, DE HAARD,HANS.

Polipéptido anti-TNF-alfa que comprende - al menos dos anticuerpos de dominio simple anti-TNF-alfa; y - al menos un anticuerpo de dominio simple dirigido contra una proteína sérica, en el que dicha proteína sérica es cualquiera de albúmina sérica, inmunoglobulinas séricas, proteína de unión a tiroxina, transferrina o fibrinógeno.

PDF original: ES-2655912_T3.pdf

Aislamiento de células multipotenciales adultas por fosfatasa alcalina no específica de tejido.

(27/09/2017). Solicitante/s: Mesoblast, Inc. Inventor/es: GRONTHOS,Stan, ZANNETTINO,ANDREW CHRISTOPHER WILLIAM.

Una población enriquecida de células multipotenciales adultas TNAP+ donde al menos un 4 % de la población celular total son células multipotenciales TNAP+ STRO-1+ aptas para cultivarse in vitro produciendo adipocitos, osteocitos y condrocitos, donde el marcador TNAP+ es un marcador TNAP+ que se une al anticuerpo STRO-3 producido por la línea celular de hibridoma depositada en la ATCC el 19 de diciembre de 2005 bajo las disposiciones del Tratado de Budapest, con número de acceso al depósito PTA-7282.

PDF original: ES-2654428_T3.pdf

Generación y caracterización de anticuerpos terapéuticos obtenidos mediante HuCal GOLD completamente humanos específicos de CD38 humano.

(27/09/2017). Solicitante/s: MORPHOSYS AG. Inventor/es: TESAR,MICHAEL, JÄGER,UTE.

Un anticuerpo específico anti-CD38 humano que comprende: (i) una región H-CDR1, H-CDR2 y H-CDR3 descrita en SEQ ID NO: 21, y una región L-CDR1, L-CDR2 y LCDR3 descrita en SEQ ID NO: 51; (ii) una cadena pesada variable de SEQ ID NO: 21, y una cadena ligera variable de SEQ ID NO: 51; o (iii) una cadena pesada variable codificada por SEQ ID NO: 6, y una cadena ligera variable codificada por SEQ ID NO: 36.

PDF original: ES-2653664_T3.pdf

Marcadores genéticos para el alto contenido de ácido oleico en plantas.

(13/09/2017). Solicitante/s: INSTITUT NATIONAL DE LA RECHERCHE AGRONOMIQUE (INRA). Inventor/es: RENARD, MICHEL, FALENTIN,CYRIL, BREGEON,MICHEL, LUCAS,MARIE ODILE.

Ácido nucleico mutado que codifica una enzima delta-12 oleato desaturasa (FAD2) de una planta Cruciferae, en el que dicho ácido nucleico mutado consiste en (i) una secuencia que comprende la mutación no conservativa de al menos un nucleótido de al menos un codón que representa un aminoácido seleccionado del grupo que consiste en: - el aminoácido en la posición 259 de la secuencia de aminoácidos de dicha FAD2 cuando dicha secuencia de FAD2 está constituida por 384 aminoácidos, o en la posición 258 cuando dicha secuencia de FAD2 está constituida por 383 aminoácidos, o (ii) la secuencia complementaria de dicha secuencia, codificando dicho ácido nucleico mutado una FAD2 que tiene una actividad menor que la de la correspondiente FAD2 natural medida en las mismas condiciones.

PDF original: ES-2651621_T3.pdf

Moléculas de anticuerpos que se unen a la trombina y usos de las mismas.

(06/09/2017). Solicitante/s: Janssen Pharmaceuticals, Inc. Inventor/es: BAGLIN,Trevor, HUNTINGTON,JAMES ANDREW, LANGDOWN,JONATHAN.

Una molécula de anticuerpo aislada que se une específicamente en la región del exositio 1 de la trombina, donde la molécula de anticuerpo comprende un dominio VH que comprende unas HCDR1, HCDR2 y HCDR3 que tienen las secuencias de SEQ ID NO: 3, 4 y 5, respectivamente, y un dominio VL que comprende unas LCDR2 y LCDR3 que tienen las secuencias de SEQ ID NO: 8 y 9, respectivamente, y una LCDR1 que tiene la secuencia de SEQ ID NO: 7 o una LCDR1 que tiene la secuencia de la SEQ ID NO: 7 en la que el sitio de glicosilación está mutado por la introducción de una sustitución de un resto de aminoácido que se corresponde con la S30 de la SEQ ID NO: 6.

PDF original: ES-2642718_T3.pdf

Inhibidores de Factor XII para la administración con procedimientos médicos que comprenden contacto con superficies artificiales.

(09/08/2017) Inhibidor de FXII/FXIIa para su uso en la prevención de la formación y/o estabilización de trombos durante y/o después de un procedimiento médico llevado a cabo en un sujeto humano o animal que comprende poner en contacto sangre de dicho sujeto humano o animal con superficies artificiales, donde dicho inhibidor de FXII/FXIIa se administra antes y/o durante y/o después de dicho procedimiento médico y además donde (i) la superficie artificial se expone a al menos un 80% del volumen de sangre del sujeto y la superficie artificial es de al menos 0.2 m2 o (ii) la superficie artificial es un recipiente para la recolección de sangre fuera del cuerpo del sujeto o (iii)…

Descubrimiento innovador de composiciones terapéuticas, de diagnóstico y de anticuerpos relacionadas con fragmentos de proteínas de triptofanil-ARNt sintetasas.

(02/08/2017). Solicitante/s: Atyr Pharma, Inc. Inventor/es: VASSEROT, ALAIN, P., MENDLEIN,JOHN,D, WATKINS,JEFFRY,D, GREENE,LESLIE ANN, CHIANG,KYLE P, HONG,FEI, LO,WING-SZE, QUINN,CHERYL L.

Una composición terapéutica, que comprende un polipéptido de aminoacil-ARNt sintetasa (AARS) aislado de aproximadamente 100 a aproximadamente 280 aminoácidos de longitud y que comprende una secuencia de aminoácidos que es al menos un 90 %, un 95 %, un 98 % o un 100 % idéntica a 100 aminoácidos contiguos de las SEQ. ID. NO.: 56, 16 o 48, en la que el polipéptido tiene una actividad de señalización extracelular y una solubilidad de al menos aproximadamente 5 mg/ml y en donde la composición tiene una pureza de al menos aproximadamente el 95 % en proteínas y menos de aproximadamente 10 UE de endotoxina/mg de proteína.

PDF original: ES-2645019_T3.pdf

Anticuerpos que se unen a la proteína tirosina fosfatasa beta humana (HPTP-beta) y usos de los mismos.

(12/07/2017). Solicitante/s: Aerpio Therapeutics Inc. Inventor/es: ROTELLO,ROCCO JAMIE, PETERS,KEVIN GENE, DAVIS,MICHAEL GLEN.

Un anticuerpo aislado que se une a la proteína tirosina fosfatasa beta humana (HPTPß), en donde el anticuerpo aislado es un anticuerpo monoclonal, en donde el anticuerpo monoclonal comprende dos cadenas pesadas idénticas y dos cadenas ligeras idénticas, en donde dicho anticuerpo aislado regula positivamente la angiogénesis, en donde el anticuerpo aislado se une a la primera repetición FN3 de HPTPß, en donde la primera repetición FN3 de HPTPß tiene la secuencia mostrada en SEQ ID NO: 11.

PDF original: ES-2643469_T3.pdf

Diagnóstico de carcinoma de ovario.

(31/05/2017). Solicitante/s: PACIFIC NORTHWEST RESEARCH INSTITUTE. Inventor/es: HELLSTROM, INGEGERD, HELLSTROM, KARL, ERIK, LEDBETTER, JEFFREY A., HAYDEN-LEDBETTER,MARTHA, SCHUMMER,MICHEL.

Un método in vitro para detectar la presencia de un carcinoma de ovario en un sujeto que comprende: poner en contacto una muestra biológica de un sujeto con al menos un anticuerpo específico para un polipéptido antigénico que consiste de la secuencia de aminoácidos expuesta en la SEQ ID NO: 11 para determinar la presencia en dicha muestra biológica de una molécula de origen natural en forma soluble en dicha muestra y que tiene un determinante antigénico que es reactivo con dicho al menos un anticuerpo, bajo condiciones y durante un tiempo suficiente para detectar la unión de dicho anticuerpo a dicho determinante antigénico, y a partir de allí detectar la presencia de carcinoma de ovario caracterizado porque la muestra biológica se selecciona del grupo que consiste en: una muestra de sangre; una muestra de suero; y una muestra de plasma.

PDF original: ES-2628952_T3.pdf

Derivados anticancerosos, preparación de los mismos y uso terapéutico de los mismos.

(31/05/2017) Compuesto de fórmula (I):**Fórmula** en el que: • ---- representa un enlace sencillo o un doble enlace, con la condición de que si ---- representa un enlace sencillo, entonces: • U y/o U', que pueden ser idénticos o diferentes, representan, independientemente entre sí, H; • W y/o W', que pueden ser idénticos o diferentes, representan, independientemente entre sí: OH, -OR, -OCOR, -COOR, -OCOOR, -OCONRR', un carbamato cíclico tal que N10 y C11 se incluyan en un anillo, -NRCONRR', -OCSNHR, un tiocarbamato cíclico tal que N10 y C11 se incluyan en un anillo, -SH, -SR, -SOR, -SOOR, -SO3 -, -NRSOOR', -NRR', una amina cíclica tal que N10 y C11 se incluyan en un anillo, -NROR', -NRCOR', -N3, -CN, Hal, un grupo trialquilfosfonio o triarilfosfonio; …

Anticuerpos e inmunoconjugados y usos para los mismos.

(03/05/2017). Solicitante/s: GENENTECH, INC.. Inventor/es: JAKOBOVITS, AYA, DENNIS, MARK, S., POLAKIS,PAUL, RUBINFELD,Bonnee.

un anticuerpo monoclonal humanizado que se une a STEAP-1, en donde el anticuerpo comprende una cadena pesada (HC), que comprende: una HVR-H1 que comprende la secuencia de aminoácidos de SEQ ID NO: 14; una HVR-H2 que comprende la secuencia de aminoácidos de SEQ ID NO: 15; una HVR-H3 que comprende la secuencia de aminoácidos de SEQ ID NO: 16; y una HC-FR1 que comprende la secuencia de aminoácidos de SEQ ID NO: 25; y una cadena ligera (LC) que comprende: una HVR-L1 que comprende la secuencia de aminoácidos de SEQ ID NO: 11; una HVR-L2 que comprende la secuencia de aminoácidos de SEQ ID NO: 12; y una HVR-L3 que comprende la secuencia de aminoácidos de SEQ ID NO: 13, en donde el anticuerpo es un anticuerpo biespecífico.

PDF original: ES-2636089_T3.pdf

Métodos para tratar afecciones asociadas con la activación del complemento dependiente de MASP-2.

(29/03/2017). Ver ilustración. Solicitante/s: UNIVERSITY OF LEICESTER. Inventor/es: SCHWAEBLE,HANS-WILHELM, STOVER,CORDULA M, TEDFORD, CLARK, E., PARENT, JAMES B., FUJITA,TEIZO.

Un anticuerpo o fragmento del mismo anti-MASP-2 inhibidor de MASP-2 que se une específicamente a una porción de la SEQ ID NO: 6 e inhibe selectivamente la activación del complemento dependiente de MASP-2 sin inhibir sustancialmente la activación del complemento dependiente de C1q para usar en el tratamiento de un sujeto que padece angiopatía diabética.

PDF original: ES-2628867_T3.pdf

Métodos para tratar afecciones asociadas con la activación del complemento dependiente de MASP-2.

(29/03/2017). Ver ilustración. Solicitante/s: OMEROS CORPORATION. Inventor/es: PARENT, JAMES B., TEDFORD, CLARK, E., FUJITA,TEIZO, SCHWAEBLE,HANS-WILHELM, STOVER,CORDULA M.

Un agente inhibidor de MASP-2 para usar en el tratamiento de un sujeto que padece una afección renal mediada por complemento dependiente de MASP-2 seleccionada del grupo que consiste en glomerulonefritis mesangioproliferativa, glomerulonefritis membranosa, glomerulonefritis membranoproliferativa (glomerulonefritis mesangiocapilar), glomerulonefritis postinfecciosa aguda (glomerulonefritis postestreptocócica), glomerulonefritis crioglobulinémica, nefritis lúpica, nefritis purpura de Henoch-Schonlein y nefropatía por IgA, en donde el agente inhibidor de MASP-2 es un anticuerpo anti-MASP-2 o fragmento del mismo que se une específicamente a una porción de la SEQ ID NO: 6 y selectivamente inhibe la activación del complemento dependiente de MASP-2 sin inhibir sustancialmente la activación del complemento dependiente de C1q.

PDF original: ES-2631127_T3.pdf

Anticuerpo novedoso contra una anhidrasa carbónica.

(29/03/2017). Solicitante/s: HELMHOLTZ ZENTRUM MUNCHEN DEUTSCHES FORSCHUNGSZENTRUM FUR GESUNDHEIT UND UMWELT (GMBH). Inventor/es: KREMMER, ELISABETH, DR., ZEIDLER,REINHARD, BATTKE,CHRISTINA, FLATLEY,ANDREW, SUPURAN,CLAUDIU.

Un anticuerpo que se une a anhidrasa carbónica XII, en donde el anticuerpo comprende las secuencias de aminoácidos SEQ ID NO 1 (CDR1), 2 (CDR2) y 3 (CDR3) que determinan las CDR de la región VH, y las secuencias de aminoácidos SEQ ID NO 4 (CDR1), 5 (CDR2) y 6 (CDR3) que determinan las CDR de la región VL.

PDF original: ES-2629348_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · ››