Proteínas de unión a calicreína plasmática.

Un anticuerpo que se une a la forma activa de calicreína plasmática humana y no se une a precalicreína humana,

y en el que el anticuerpo se selecciona del grupo que consiste en (i) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY

ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVS S y secuencia VL de DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRF

SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (ii) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGS LRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGI

TVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRTGIPRRDAFDIWG QGTMVTVSSASTKGPSVFPLAPSSKS y una secuencia VL de QDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPNLLIYKASTLESG VPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK; (iii) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYLMTWVRQAPGKGLEWVSYISPSGGHTIY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVARGIAARSRTSYFDYWGQGTLV TVSS y una secuencia VL de EIVLTQSPGTLSLSPGERATLSCRTSQFVNSNYLAWYQQKPGQAPRLLIYGASSRATGIP

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQSSRTPWTFGQGTKVEIK; (iv) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAA

SGFTFSHYLMTWVRQAPGKGLEWVSYISPSGGHTIYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCARVARGIAARSRTSYFDYWGQGTLVTVSSASTKGPSVFP LAPSSKS y una secuencia VL de QDIQMTQSPG TLSLSPGERATLSCRTSQFVNSNYLAWYQQTPGQAPRLLIYGASSRAT GIPDRFSGTGYGTDFTLTISRLEPEDYGTYYCQQSSRTPWTFGQGTRVEIK; (v) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYLMTWVRQAPGKGLEWVSYISPSGGHTIY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVARGIAARSRTSYFDYWGQGTLV TVSS y una secuencia VL de EIVLTQSPGTLSLSPGERATLSCRTSQFVNSNYLAWYQQKPGQAPRLLIYGASSRATGIPDR

FSGSGSGTDFTLTISRLEPEDFAVYYCQQSSRTPWTFGQGTKVEIK; (vi) un anticuerpo que comprende una secuencia VH de EVQLLESGGG LVQPGGSLRL SCAASGFTFS 30 HYLMTWVRQA PGKGLEWVSY ISPSGGHTIYADSVKGRFTI SRDNSKNTLY LQMNSLRAED TAVYYCARVA RGIAARSRTS YFDYWGQGTLVTVSSASTKG PSVFPLAPSS KS y una secuencia VL de QDIQMTQSPS FLSASVGDRV TITCRASQGI SSYLAWYQQK PGKAPKLLIYAASTLQSGVP SRFSGSGSGT EFTLTISSLQ PEDFATYYCQ QLNSYPLTFG GGTKVEIK; (vii) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSAYSMIWVRQAPGKGLEWVSYIRPSGGRTTY

ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLLLWFRELKSNYFDYWGQGT LVTVSSASTKGPSVFPLAPSSKS y una secuencia VL de

QDIQMTQSPSSLSAFVGDRVTITCRASQPIDNYLNWYHQKPGKAPKLLIYAASRLQSGVPS RLSGSGFGT DFTLTISSLQ PEDFGNYYCQ QSYTVPYTFGGGTKVEIR; 40 (viii) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSAYSMIWVRQAPGKGLEWVSY

IRPSGGRTTYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG LLLWNRELKS NYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS y una secuencia VL de QDIQMTQSPSSLSAFVGDRVTITCRASQPIDNYLNWYHQKPGKAPKLLIY

AASRLQSGVPSRLSGSGFGTDFTLTISSLQPEDFGNYYCQQSYTVPYTFGGGTKVEIR; (ix) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSAYSMIWVRQAPGKGLEWVSYIRPSGGRTTY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLLLWARELKS

NYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS y una secuencia VL de

QDIQMTQSPSSLSAFVGDRVTITCRASQPIDNYLNWYHQKPGKAPKLLIYAASRLQSGVPS

RLSGSGFGTDFTLTISSLQPEDFGNYYCQQSYTVPYTFGGGTKVEIR; (x) un anticuerpo que comprende una secuencia VH de EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYLMTWVRQAPGKGLEWVSYISPSGGHTIY

ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAMVGQGIRGRSRTSYFAQWGQGTL VTVSS y una secuencia VL de EIVLTQSPGTLSLSPGERATLSCRTSQFVNSNYLAWYQQKPGQAPRLLIYGASSRATGIPDR

FSGSGSGTDFTLTISRLEPEDFAVYYCQQSSRTPWTFGQGTKVEIK;

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2011/020377.

Solicitante: DYAX CORP..

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 300 Shire Way Lexington, MA 02421 ESTADOS UNIDOS DE AMERICA.

Inventor/es: SEXTON,DANIEL J, VISWANATHAN,MALINI.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/395 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53). › Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.
  • C07K16/18 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra materiales animales o humanos.
  • C07K16/40 C07K 16/00 […] › contra enzimas.

PDF original: ES-2688093_T3.pdf

 

  • Fb
  • Twitter
  • G+
  • 📞
  • Pinit
Proteínas de unión a calicreína plasmática.

Patentes similares o relacionadas:

Anticuerpos que se unen a TL1A y sus usos, del 8 de Noviembre de 2018, de GLENMARK PHARMACEUTICALS S.A.: Un anticuerpo o fragmento del mismo que se une a TL1A humano, murino, de rata y de cynomolgus que comprende una CDR1 de cadena pesada que comprende la secuencia […]

Formulaciones con oxidación reducida, del 7 de Noviembre de 2018, de F. HOFFMANN-LA ROCHE AG: Una formulación líquida que comprende una proteína y un compuesto que previene la oxidación de la proteína en la formulación líquida, en la que el compuesto […]

Antagonistas del receptor 1 del factor de necrosis tumoral para tratar enfermedades respiratorias, del 7 de Noviembre de 2018, de DOMANTIS LIMITED: El uso de un dominio variable único de inmunoglobulina que es un VH, VL o VHH que tiene al menos 96% de identidad a lo largo de su longitud completa, según se determina […]

Método para producir formulaciones sólidas que comprenden dominios variables individuales de inmunoglobulina, del 5 de Noviembre de 2018, de ABLYNX N.V: Método de producción de una formulación sólida de un dominio variable individual de inmunoglobulina, que es un procedimiento de granulación en húmedo o un procedimiento […]

Productos génicos de expresión diferencial en tumores y su uso, del 31 de Octubre de 2018, de Ganymed Pharmaceuticals GmbH: Composición farmacéutica para su uso en un método para el tratamiento de una enfermedad de cáncer que se distingue por la expresión de un antígeno asociado […]

Forrmulaciones estabilizadas que contienen anticuerpos anti-receptor de la interleucina 6 (IL-6R), del 30 de Octubre de 2018, de REGENERON PHARMACEUTICALS, INC.: Una formulación farmacéutica que comprende: (i) un anticuerpo humano que se une específicamente al receptor de interleucina 6 humano (hIL-6R), […]

Anticuerpos anti-HtrA1 y procedimientos de uso, del 30 de Octubre de 2018, de F. HOFFMANN-LA ROCHE AG: Un anticuerpo monoclonal aislado que se une a HtrA1 e inhibe su actividad serina proteasa para uno o mas sustratos para HtrA1, en el que el anticuerpo comprende […]

ÁCIDO NUCLEICO Y PROTEÍNA CORRESPONDIENTE DENOMINADA 238P1B2 ÚTIL EN EL TRATAMIENTO Y LA DETECCIÓN DE CÁNCER, del 29 de Febrero de 2012, de AGENSYS, INC.: Un procedimiento para detectar la presencia de cáncer de próstata en una muestra de ensayo, comprendiendo el procedimiento: poner en contacto […]