Plantas que tienen rasgos potenciados relacionados con el rendimiento y un procedimiento de fabricación de las mismas.

Un procedimiento para aumentar el rendimiento de las semillas en plantas con respecto a las plantas de control,

que comprende aumentar la expresión en una planta de un ácido nucleico que codifica un polipéptido SPL11, en el que dicho polipéptido SPL11 comprende un dominio SBP que tiene, en orden creciente de preferencia, una identidad de secuencia de al menos 70 %, 75 %, 80 %, 90 %, 95 %, 97 % o más con una cualquiera de SEC ID Nº: 456 a SEC ID Nº: 468 y SEC ID Nº: 478, en el que dicho rendimiento de semilla aumentado comprende preferentemente aumento del peso total de semilla, del número de semillas llenas, del número de semillas o floretes por panícula, del peso de mil granos, de la tasa de llenado de la semilla y/o del índice de cosecha, con respecto a plantas de control.

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E09178941.

Solicitante: BASF PLANT SCIENCE GMBH.

Nacionalidad solicitante: Alemania.

Dirección: 67056 LUDWIGSHAFEN ALEMANIA.

Inventor/es: HATZFELD,YVES, FRANKARD,VALERIE, SANZ MOLINERO,ANA ISABEL, SHIRLEY,Amber, MCKERSIE,Bryan, DARNIELLE,LALITREE, VANDENABEELE,STEVEN.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A01H5/00 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A01 AGRICULTURA; SILVICULTURA; CRIA; CAZA; CAPTURA; PESCA.A01H NOVEDADES VEGETALES O PROCEDIMIENTOS PARA SU OBTENCION; REPRODUCCION DE PLANTAS POR TECNICAS DE CULTIVO DE TEJIDOS.Plantas con flores, es decir, angiospermas.
  • C07K14/415 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › de vegetales.
  • C12N15/82 C […] › C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00). › C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K). › para células vegetales.

PDF original: ES-2539530_T3.pdf

 


Fragmento de la descripción:

Plantas que tienen rasgos potenciados relacionados con el rendimiento y un procedimiento de fabricación de las mismas

La presente solicitud se refiere, en líneas generales, al campo de la biología molecular y atañe a un procedimiento para potenciar rasgos relacionados con el rendimiento y/o mejorar diversas características del crecimiento de las plantas modulando en una planta la expresión de un ácido nucleico que codifica una PRC (Proteína Reguladora del Crecimiento). La PRC es un polipéptido del factor de la transcripción de la proteína de unión al promotor Squamosa de tipo 11 (SPL11). La presente invención también atañe a plantas que tienen expresión modulada de un ácido nucleico que codifica una PRC, cuyas plantas tienen características de crecimiento mejoradas con respecto a plantas de tipo silvestre correspondientes u otras plantas de control. La invención también proporciona nuevos ácidos nucleicos de PRC y polipéptidos de PRC así como construcciones útiles en los procedimientos de la invención.

El continuo aumento de la población mundial y la disminución de suministro de tierra cultivable disponible para la agricultura incentivan la investigación hacia el aumento de la eficiencia de la agricultura. Los medios convencionales para mejoras de cultivo y hortícolas utilizan técnicas de siembra selectiva para identificar plantas que tienen características deseables. Sin embargo, dichas técnicas de siembra selectiva tienen diversos inconvenientes, en concreto, que estas técnicas son típicamente laboriosas y producen plantas que a menudo contienen componentes genéticos heterógenos que no siempre producen el rasgo deseable que se transmite desde las plantas progenitoras. Los avances en biología molecular han permitido a la humanidad modificar el plasma germinal de animales y plantas. La ingeniería genética de las plantas conlleva el aislamiento y la manipulación de material genético (típicamente en forma de ADN o ARN) y la introducción posterior de ese material genético en una planta. Dicha tecnología tiene la capacidad de producir cultivos o plantas que tienen diversos rasgos económicos, agronómicos u hortícolas mejorados.

Un rasgo de interés económico particular es el aumento del rendimiento. El rendimiento se define normalmente como el producto medible de valor económico de un cultivo. Esto puede definirse en términos de cantidad y/o calidad. El rendimiento depende directamente de diversos factores, por ejemplo, del número y tamaño de los órganos, de la arquitectura de la planta (por ejemplo, del número de ramas), de la producción de semillas, de la senescencia de las hojas y de más factores. El desarrollo de raíces, la absorción de nutrientes, la tolerancia al estrés, y el vigor temprano también pueden ser factores importantes en la determinación del rendimiento. Por lo tanto, optimizar los factores mencionados anteriormente puede contribuirá aumentar el rendimiento del cultivo.

El rendimiento de las semillas es un rasgo particularmente importante, ya que las semillas de muchas plantas son importantes para la nutrición humana y animal. Cultivos tales como maíz, arroz, trigo, cañóla y soja representan más de la mitad de la ingesta calórica humana total, bien a través del consumo directo de las propias semillas o a través del consumo de productos cárnicos generados sobre semillas procesadas. También son una fuente de azúcares, aceites y muchos tipos de metabolitos utilizados en los procesos industriales. Las semillas contienen un embrión (la fuente de nuevos brotes y raíces) y un endospermo (la fuente de nutrientes para el crecimiento del embrión durante la germinación y durante el crecimiento temprano de las plántulas). El desarrollo de una semilla implica muchos genes y requiere la transferencia de metabolitos desde las raíces, hojas y tallos al interior de la semilla en crecimiento. El endospermo, en particular, asimila los precursores metabólicos de los carbohidratos, aceites y proteínas y los sintetiza en macromoléculas de almacenamiento para llenar el grano.

Otro rasgo importante para muchos cultivos es el vigor temprano. Mejorar el vigor temprano es un objetivo importante de los programas de siembra de arroz modernos en variedades de cultivo de arroz tanto de clima templado como tropical. Las raíces largas son importantes para el anclaje adecuado al suelo en arroz sembrado en agua. Cuando el arroz se siembra directamente en campos inundados, y cuando las plantas deben emerger rápidamente a través del agua, los brotes más alargados se asocian con el vigor. Cuando se practica siembra con perforación, para la buena emergencia de las plántulas, son importantes mesocótilos y coleóptilos más alargados. La capacidad de modificar genéticamente el vigor temprano en plantas sería de gran importancia en la agricultura. Por ejemplo, un vigor temprano pobre ha sido una limitación para la introducción de híbridos de maíz (Zea mays L.) basados en plasma germinal del Cinturón de Maíz en el Atlántico Europeo.

Un rasgo importante adicional es el de tolerancia mejorada al estrés abiótico. El estrés abiótico es la causa principal de pérdidas de cultivo en todo el mundo, reduciendo en más de un 50 % los rendimientos promedio para la mayoría de las plantas de cultivo principales (Wang y col., Planta (2003) 218: 1-14). El estrés abiótico puede producirse por sequía, salinidad, temperaturas extremas, toxicidad química y estrés oxidativo. La capacidad de mejorar la tolerancia de la planta al estrés abiótico sería de gran ventaja económica para los granjeros de todo el mundo y permitiría la cosecha de cultivos durante condiciones adversas y en territorios cuando la cosecha de cultivos no pueda ser posible de otra forma.

Por lo tanto el rendimiento del cultivo puede aumentarse optimizando uno de los factores mencionados anteriormente.

Dependiendo del uso final, la modificación de determinados rasgos de rendimiento puede estar favorecida sobre otros. Por ejemplo, para aplicaciones tales como forraje o producción de madera, o fuente de biocombustible, puede ser deseable un aumento en las partes vegetativas de una planta, y para aplicaciones tales como producción de harina, almidón o aceite, el aumento en los parámetros de semilla puede ser particularmente deseable. Incluso entre los parámetros de semilla, algunos pueden estar favorecidos sobre otros, dependiendo de la aplicación. Diversos mecanismos pueden contribuir a aumentar el rendimiento de las semillas, ya sea que esté en la forma de tamaño de semilla aumentado o número de semilla aumentado.

Una estrategia para aumentar el rendimiento (rendimiento de semillas y/o biomasa) en las plantas puede ser a través de la modificación de los mecanismos de crecimiento intrínsecos de una planta, tal como el ciclo celular o diversas rutas de señalización implicados en el crecimiento de la planta o en los mecanismos de defensa.

Sorprendentemente, ahora se ha descubierto que la modulación de la expresión de un ácido nucleico que codifica un polipéptido del factor de la transcripción de la proteína de unión al promotor Squamosa de tipo 11 (SPL11) produce pantas que tienen rasgos potenciados relacionados con el rendimiento y/o mejora diversas características del crecimiento de las plantas en relación con las plantas de control.

De acuerdo con un aspecto de la solicitud, se proporciona un método para mejorar o potenciar rasgos relacionados con el rendimiento y/o mejorar diversas características del crecimiento de las plantas de una planta con relación a plantas de control, que comprende modular en una planta la expresión de un ácido nucleico que codifica un polipéptido del factor de la transcripción de la proteína de unión al promotor Squamosa de tipo 11 (SPL11).

Antecedentes

Proteína de unión al promotor Squamosa de tipo 11 (SPL11)

Los polipéptidos de factores de transcripción normalmente se definen como proteínas que muestran afinidad de unión al ADN específica de secuencias y que son capaces de activar y/o reprimir la transcripción. Los polipéptidos del factor de la transcripción de la proteína de unión al promotor Squamosa de tipo 11 (SPL, por las siglas en inglés Squamosa gromoter binding protein-Jike) son proteínas estructuralmente diversas que comparten un dominio de unión al ADN (DBD, por sus siglas en inglés DNA binding domain) muy conservado de aproximadamente 80 restos de aminoácidos de longitud (Klein y col. (1996) Mol Gen Genet 259: 7-16; Cardón y col. (1999) Gene 237: 91-104). El sitio de unión a la secuencia consenso del ADN del factor de la transcripción de SPL en el promotor de genes diana es 5-TNCGTACAA-3 donde N representa cualquier base. Dentro del DBD de SPL hay diez restos de cisteína (Cys) o histidina (His)... [Seguir leyendo]

 


Reivindicaciones:

1. Un procedimiento para aumentar el rendimiento de las semillas en plantas con respecto a las plantas de control, que comprende aumentar la expresión en una planta de un ácido nucleico que codifica un polipéptido SPL11, en el que dicho polipéptido SPL11 comprende un dominio SBP que tiene, en orden creciente de preferencia, una identidad de secuencia de al menos 70 %, 75 %, 80 %, 90 %, 95 %, 97 % o más con una cualquiera de SEC ID N°: 456 a SEC ID N°: 468 y SEC ID N°: 478, en el que dicho rendimiento de semilla aumentado comprende preferentemente aumento del peso total de semilla, del número de semillas llenas, del número de semillas o floretes por panícula, del peso de mil granos, de la tasa de llenado de la semilla y/o del índice de cosecha, con respecto a plantas de control.

2. El procedimiento de acuerdo con la reivindicación 1, en el que dicho polipéptido SPL11, además del dominio SBP, comprende uno cualquiera o más de los siguientes motivos conservados:

(i) Motivo 1 como se representa por la SEC ID N°: 469 en el que se permite cualquier sustitución de aminoácidos conservativa y/o 1 o 2 sustituciones no conservativas;

(ii) Motivo 2 como se representa por la SEC ID N°: 470 en el que se permite cualquier cambio, a condición de que al menos 4 aminoácidos tengan una cadena lateral polar, preferentemente serina o treonina, y a condición de que el dominio se localice en el extremo N terminal del dominio SBP;

(iii) Motivo 3 como se representa por la SEC ID N°: 471, en el que se permiten 1 o 2 emparejamientos erróneos;

(iv) Motivo 4 como se representa por la SEC ID N°: 472, en el que se permiten 1, 2 o 3 emparejamientos erróneos.

3. El procedimiento de acuerdo con la reivindicación 1 o 2, en el que dicha expresión aumentada se efectúa introduciendo y expresando en una planta un ácido nucleico que codifica un polipéptido SPL11 como se define en la reivindicación 1 o 2.

4. El procedimiento de acuerdo con cualquiera de las reivindicaciones 1 a 3, en el que dicho ácido nucleico que codifica un polipéptido SPL11 codifica una cualquiera de las proteínas indicadas en la Tabla G1 o es una porción de dicho ácido nucleico, o un ácido nucleico capaz de hibridar con dicho ácido nucleico y/o en el que dicha secuencia de ácido nucleico codifica un ortólogo o parálogo de cualquiera de las proteínas indicadas en la Tabla G1 y/o en el que dicho ácido nucleico codifica la SEC ID N°: 428.

5. El procedimiento de acuerdo con cualquiera de las reivindicaciones 1 a 4, en el que dicho rendimiento de semilla aumentado se obtiene en condiciones de no estrés y/o en el que dicho rendimiento de semilla aumentado se obtiene en condiciones de crecimiento con estrés por sequía leve.

6. El procedimiento de acuerdo con una cualquiera de las reivindicaciones 1 a 5, en el que dicho ácido nucleico está unido operativamente a un promotor constitutivo, preferentemente a un promotor GOS2, más preferentemente a un promotor GOS2 de arroz y/o en el que dicho ácido nucleico está unido operativamente a un promotor específico de semilla, preferentemente a un promotor WSI18, más preferentemente a un promotor WSI18 de arroz.

7. Una molécula de ácido nucleico aislada que comprende:

(i) un ácido nucleico representado por la SEC ID N°: 448;

(ii) el complemento de un ácido nucleico representado por la SEC ID N°: 448;

(iii) un ácido nucleico que codifica un polipéptido SPL11 que tiene, en orden creciente de preferencia, una identidad de secuencia de al menos 70 %, 75 %, 80 %, 85 %, 90 %, 95 %, 96 %, 97 %, 98 %, 99 % o más con la secuencia de aminoácidos representada por SEC ID N°: 449, y que tiene, en orden creciente de preferencia, una identidad de secuencia de al menos 70 %, 75 %, 80 %, 85 %, 90 %, 95 %, 96 %, 97 %, 98 %, 99 % o más con la SEC ID N°: 465:

SYCQVEGCRTDLSSAKDYHRKHRVCEPHSKAPKWVAGLERRFCQQCSRFHGLAEFDQKKKSCRRR

LNDHNARRRKPQPEAL.

8. Un polipéptido de la proteína de unión al promotor squamosa aislado de tipo 11 (SPL11) que comprende:

(i) una secuencia de aminoácidos representada por la SEC ID N°: 449;

(ii) una secuencia de aminoácidos que tiene, en orden creciente de preferencia, una identidad de secuencia de al menos 70 %, 75 %, 80 %, 85 %, 90 %, 95 %, 96 %, 97 %, 98 %, 99 % o más con la secuencia de aminoácidos representada por la SEC ID N°: 449, y que tiene, en orden creciente de preferencia, una identidad de secuencia de al menos 70 %, 75 %, 80 %, 85 %, 90 %, 95 %, 96 %, 97 %, 98 %, 99 % o más con la SEC ID N°: 465:

SYCQVEGCRTDLSSAKDYHRKHRVCEPHSKAPKWVAGLERRFCQGCSRFHGLAEFDQKKKSCRRR

LNDHNARRRKPQPEAL.

9. Una construcción que comprende:

(i) un ácido nucleico que codifica un polipéptido SPL11 como se define en la reivindicación 1, 2 o 7;

(ii) una o más secuencias de control capaces de dirigir la expresión de la secuencia de ácidos nucleicos de (i); y opcionalmente

(iii) una secuencia de terminación de la transcripción.

10. Una construcción de acuerdo con la reivindicación 9, en la que una de dichas secuencias de control es un promotor constitutivo, preferentemente un promotor GOS2, más preferentemente un promotor GOS2 de arroz y/o en la que una de dichas secuencias de control es un promotor específico de semilla, preferentemente un promotor WSI18, más preferentemente un promotor WSI18 de arroz.

11. El uso de una construcción de acuerdo con la reivindicación 9 o 10, en un procedimiento para fabricar plantas que tienen rendimiento de semilla aumentado con respecto a plantas de control.

12. Una planta, parte de planta o célula de la planta transformada con una construcción de acuerdo con la reivindicación 9 o 10.

13. Un procedimiento para la producción de una planta transgénica que tiene rendimiento de semilla aumentado con respecto a las plantas de control, que comprende:

(i) introducir y expresar en una planta un ácido nucleico que codifica un polipéptido SPL11 como se define en la reivindicación 1, 2 o 7; y

(ii) cultivar la célula de planta en condiciones que promuevan el crecimiento y el desarrollo de la planta.

14. Una planta transgénica que tiene rendimiento de semilla aumentado con respecto a plantas de control, resultante de la expresión aumentada de un transgén de ácido nucleico que codifica un polipéptido SPL11 como se define en la reivindicación 1,2 o 7, o una célula de planta transgénica procedente de dicha planta transgénica.

15. Planta transgénica de acuerdo con la reivindicación 12 o 14, o una célula de planta transgénica procedente de la misma, en la que dicha planta es una planta de cultivo dicotiledónea tal como soja, algodón o cañóla o una planta de cultivo monocotiledónea o cereal, tal como arroz, maíz, trigo, centeno, mijo, cebada, triticale, sorgo y avena y en la que dicha planta o célula de la planta transgénica comprende un ácido nucleico recombinante que codifica un polipéptido SLP11 como se define en la reivindicación 1, 2 o 7.

16. Partes cosechables de una planta de acuerdo con la reivindicación 15, en las que dichas partes cosechables son preferentemente biomasa de brotes, flores y/o semillas, y en las que las células de dichas partes cosechables comprenden un ácido recombinante que codifica un polipéptido SPL11 como se define en la reivindicación 1, 2 o 7.

17. El uso de un ácido nucleico que codifica un polipéptido SPL11 como se define en la reivindicación 1,2 o 7, para aumentar el rendimiento de semillas y/o la biomasa de brotes en las plantas con respecto a plantas de control.


 

Patentes similares o relacionadas:

Modulación de enfermedad por ingeniería genética de plantas, del 8 de Mayo de 2019, de THE REGENTS OF THE UNIVERSITY OF CALIFORNIA: Una planta de tomate transgénica que comprende células que expresan un péptido del que uno o más dominios comprenden la secuencia de aminoácidos DWLKAFYDKFFEKFKEFF […]

Variantes termoestables de fitasa, del 8 de Mayo de 2019, de NOVOZYMES A/S: Variante de fitasa que tiene al menos un 85 % de identidad con la SEQ ID n.º 2 y que comprende al menos un puente disulfuro en comparación con la SEQ ID n.º 2, en la que […]

Transformación de cítricos juveniles y maduros, del 3 de Mayo de 2019, de Integrated Plant Genetics, Inc: Un método para transformar una célula de una planta de cítrico madura, que comprende: (a) colocar secciones de tallo que comprenden células de la planta […]

Planta mutante, del 1 de Mayo de 2019, de UNIVERSITY OF TSUKUBA: Una planta mutante que comprende una proteína Della mutante, en que la proteína Della mutante tiene una secuencia de aminoácidos que tiene una identidad de […]

Proteínas variantes con secuencias de aminoácidos Cry1Da1 activas contra lepidópteros, del 1 de Mayo de 2019, de MONSANTO TECHNOLOGY, LLC: Una la proteína insecticida genomanipulada que comprende una secuencia de aminoácidos como se define en cualquiera de las SEQ ID NO:44, SEQ […]

Uso de Cry1Da en combinación con Cry1Ca para el control de insectos resistentes, del 29 de Abril de 2019, de DOW AGROSCIENCES LLC: Una planta transgénica que comprende ADN que codifica una proteína insecticida Cry1Da y ADN que codifica una proteína insecticida Cry1Ca.

Dispositivo de infiltración de plantas, del 10 de Abril de 2019, de MEDICAGO INC.: Un dispositivo de infiltración de plantas para infiltrar plantas con un inóculo, comprendiendo el dispositivo : un armazón que tiene uno […]

Plantas con rasgos útiles y métodos relacionados, del 10 de Abril de 2019, de THE BOARD OF REGENTS OF THE UNIVERSITY OF NEBRASKA: Una planta que presenta un rasgo útil obtenido mediante un método que comprende las etapas de a. suprimir la expresión de un(os) gen(es) MSH1 en una primera planta o célula […]

Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .