Péptidos VEGF quiméricos.

Péptido quimérico que comprende:

a) al menos un epítopo de VEGF humano formado por la secuencia de aminoácidos ITMQIMRIKPHQGQHIGEMSF;



b) un epítopo de linfocitos T colaboradores formado por las secuencia de aminoácidos NSVDDALINSTIYSYFPSV, PGINGKAIHLVNNQSSE, QYIKANSKFIGITEL, FNNFTVSFWLRVPKVSASHLE, LSEIKGVIVHRLEGV, FFLLTRILTIPQSLN y TCGVGVRVRSRVNAANKKPE; y

c) un conector de 2 a 15 aminoácidos de longitud que une al menos un epítopo de VEGF al epítopo de linfocitos T colaboradores.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2005/003747.

Solicitante: THE OHIO STATE UNIVERSITY RESEARCH FOUNDATION.

Inventor/es: KAUMAYA,PRAVIN, COHN,DAVID.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/00 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).
  • A61K38/18 A61K […] › A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00). › Factores de crecimiento; Reguladores de crecimiento.
  • C07K14/515 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › Factor angiogénico; Angiogenina.
  • C07K14/52 C07K 14/00 […] › Citoquinas; Linfoquinas; Interferones.

PDF original: ES-2541779_T3.pdf

 


Fragmento de la descripción:

Péptidos VEGF quiméricos

Esta solicitud de patente reclama la prioridad de la solicitud provisional de patente U.S. n° 6/542,41 presentada el 5 de febrero de 24.

ÁMBITO TÉCNICO DE LA PRESENTE INVENCIÓN

La presente invención se refiere a composiciones para tratar pacientes con malignidades relacionadas con la sobreexpresión del VEGF, en particular el cáncer ovárico. Las composiciones de la presente Invención incluyen los péptidos definidos en la reivindicación 1.

ANTECEDENTES DE LA PRESENTE INVENCIÓN

El cáncer ovárico es la malignidad ginecológica más letal, de la cual se espera que casi 14. mujeres mueran en los Estados Unidos durante 23 [Jemal], Desgraciadamente no hay medios efectivos para la detección precoz del cáncer ovárico y más del 75% de los casos se diagnostican cuando la enfermedad ya se ha extendido al abdomen superior o a los nodos linfáticos. A pesar de la quimioterapia citotóxica intensiva tras la cirugía radical para reducir el volumen del cáncer ovárico, la supervivencia media de las mujeres con cáncer ovárico avanzado de gran volumen es inferior a 4 meses [McGuire].

Recientes estudios han demostrado el papel crítico de la anglogénesls en el desarrollo del tumor y en la formación de depósitos tumorales metastásicos. La inhibición de la anglogénesls tumoral ha surgido como una modalidad terapéutica nueva y prometedora. Se han identificado varias actividades biológicas involucradas en este complejo proceso, aunque ahora ya se sabe que el factor de crecimiento endotelial vascular (VEGF) es uno los factores pro- angiogénicos más potentes y específicos, responsable de la anglogénesls inducida por tumores [Leung], y es la diana más prometedora para la inhibición de la anglogénesls inducida por tumores. El VEGF se sobreexpresa en vahas malignidades sólidas humanas, incluyendo el cáncer ovárico [Boocock, Olsonj. La sobreexpresión del VEGF también se ha visto en mujeres con cáncer ovárico y ha resultado ser un factor de pronóstico malo [Holllngsworth, Paley, Tempfer], Por tanto el VEGF es una diana lógica contra la cual la Inmunización puede tener un papel en el tratamiento o prevención del cáncer ovárico.

Para inhibir la función del VEGF se han empleado diversas estrategias, incluyendo el receptor de VEGF (VEGFR) como diana, el uso de técnicas de terapia genética que producen oligonucleótidos antisentido, el uso de VEGFR soluble, el desarrollo de inhibidores de los receptores de tirosina quinasa (RTK) y los anticuerpos monoclonales (Mab) dirigidos contra VEGF [Kimj. El enfoque más prometedor parece ser una versión humanizada recombinante de un Mab murino anti-VEGF humano (rhuMab VEGF, Bevacizumab). Este Mab se ha probado en pacientes con cáncer metastásico [Gordon, Margolin], Sin embargo el uso de terapia de anticuerpos tiene varios inconvenientes. Las estrategias de inmunización pasiva implican de manera significativa la transferencia de anticuerpos al paciente, pero la inmunidad es efímera, porque los anticuerpos son eliminados de la circulación. Probablemente los propios anticuerpos son con frecuencia inmunogénicos, lo cual limita su empleo a largo plazo. Además una inmunización efectivamente sostenida requiere grandes volúmenes de anticuerpos.

El uso de vacunas para prevenir o tratar el cáncer ovárico es un procedimiento muy atractivo porque los efectos secundarios que produce la terapia vacunal son mínimos. Muchos cánceres expresan antígenos asociados al tumor (AAT) que sirven de dianas para las vacunas contra el cáncer. Las estrategias de inmunización han incluido vacunas de células enteras, vacunas de proteínas y de ADN, así como vacunas de péptidos; cada tipo de vacuna antitumoral tiene sus ventajas y limitaciones. Como vacunas contra el cáncer los péptidos son interesantes porque son seguros (libres de patógenos y potencial oncogénico), estables, fáciles de construir y rentables como sistema de vacunación [Dakappagari, Peoples, Kaumaya], Cabe destacar que las vacunas de péptidos producen respuestas y memoria inmunológica sostenidas, al contrario que la inmunización pasiva. Las limitaciones de las vacunas de péptidos incluyen el hecho de que los péptidos no modificados raramente son inmunogénicos; por tanto el diseño racional de los péptidos es imprescindible para el desarrollo de una vacuna antitumoral eficaz.

La patente WO 34337 (A1) describe un anticuerpo humanizado que se une específicamente al factor de crecimiento endotelial vascular (VEGF) y más específicamente a anticuerpos monoclonales humanizados contra VEGF, secuencias de polinucleótidos que codifican los anticuerpos, un método para producir los anticuerpos, composiciones farmacéuticas que comprenden el anticuerpo como ingrediente activo, agentes terapéuticos que llevan el anticuerpo como ingrediente activo para tratar enfermedades acompañadas de angiogénesis y métodos para tratar tales enfermedades.

Dan Lu y otros "Identification of the Residues in the Extracellular Región of KDR Important for Interaction with Vascular Endothelial Growth Factor and Neutralizing Anti-KDR Antibodies" [Identificación de los residuos en la región extracelular del KDR importantes para la interacción con el factor de crecimiento endotelial vascular y anticuerpos neutralizadores anti-KDR], J. Biol. Chem. 2, 275: 14321-1433) refieren que el dominio receptor de cinasa (KDR)

del factor de crecimiento endotelial vascular (VEGF) es el principal receptor humano responsable de la actividad angiogénica del VEGF. Se encontró que los anticuerpos neutrallzadores requerían el dominio 3 para una fijación eficiente y se sugiere que ciertos residuos de la región del dominio 3 son críticos para la unión del VEGF.

Yang X. y otros (Flua Xi Kou Qiang Yi Xue Za Zhi. (1999 Feb; 17(1 ):61 -2, 84, [Design and synthesizing of human vascular endothelial growth factor (VEGF) peptide (Diseño y síntesis del péptido del factor de crecimiento endotelial vascular (VEGF) humano)]) pretenden predecir epítopos continuos del VEGF utilizando péptido sintético de VEGF como antígeno para producir anticuerpo monoclonal anti-péptido de VEGF. De acuerdo con la secuencia amínica del VEGF189 se empleó el programa de índice de antígenos y el software Goldkey para predecir los epítopos del VEGF y se sintetizó el péptido que contenía uno de los epítopos predichos. La secuencia NH2-terminal de los aminoácidos 1-26 del VEGF se definió como péptido sintético y se sintetizó.

La patente US 6339139 (B1) se refiere a un sistema de transferencia genética para la unión a un receptor del factor de crecimiento, que incluye un complejo de 4 elementos formado por ligando oligopeptídico/polipéptido policatiónico/ oligopéptido de liberación endosómica/ADN exógeno, o de 3 elementos, constituido por ligando oligopeptídico/ polipéptido policatiónico/ oligopéptido de liberación endosómica/ADN exógeno. La presente invención ejemplifica entre otras cosas sistemas GV2 que pueden usarse como dianas para la introducción de genes exógenos en células de tumores malignos o en endoteliocitos vasculares de tumores.

También son capaces de inhibir en gran medida el crecimiento de células tumorales en animales, mientras que las proteínas p15, p16 o p21WAF-1 se usaron como genes exógenos.

La patente US 76284 (B1) describe composiciones para estimular el sistema inmunitario y tratar malignidades relacionadas con la sobreexpresión de la proteína HER-2. Estas composiciones incluyen epítopos inmunogénicos de las proteínas HER-2 y péptidos quiméricos y multivalentes que comprenden dichos epítopos.

RESUMEN DE LA PRESENTE INVENCIÓN

La presente invención aporta nuevos compuestos y composiciones para estimular el sistema inmunitario y tratar malignidades relacionadas con la sobreexpresión de la proteína VEGF. Los compuestos son péptidos quiméricos tal como están definidos en la reivindicación 1.

En lo sucesivo se alude colectivamente a estos compuestos como "epítopos de VEGF". El epítopo de VEGF consta del aminoácido 12 hasta el aminoácido 122 del VEGF.

La secuencia del VEGF humano es:

1 MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNH hewkfmdvyqrsychpietld

61 ifqeypdeieyifkpscvplmrcggcsndeglecvpteesnitmqimrikphqgqhigem

121 SFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVGDPQTCKCSCKNTHSRCKARQLELN

181 ERTCRCDKPRR 191

La presente invención aporta péptidos quiméricos, designados en lo sucesivo como "péptidos de VEGF quiméricos", que incluyen el presente epítopo de VEGF. Los péptidos de VEGF quiméricos tienen preferiblemente una longitud aproximada de 35 a 15, con mayor preferencia de 35 a 7 aminoácidos. Los péptidos de VEGF quiméricos poseen tres unidades. La primera unidad comprende el epítopo de VEGF.... [Seguir leyendo]

 


Reivindicaciones:

1. Péptido quimérico que comprende:

a) al menos un epítopo de VEGF humano formado por la secuencia de aminoácidos ITMQIMRIKPHQGQHIGEMSF;

b) un epítopo de linfocitos T colaboradores formado por las secuencia de aminoácidos NSVDDALINSTIYSYFPSV, PGINGKAIHLVNNQSSE, QYIKANSKFIGITEL, FNNFTVSFWLRVPKVSASHLE, LSEIKGVIVHRLEGV, FFLLTRILTIPQSLN y TCGVGVRVRSRVNAANKKPE; y

c) un conectar de 2 a 15 aminoácidos de longitud que une al menos un epítopo de VEGF al epítopo de linfocitos T colaboradores.

2. El péptido quimérico según la reivindicación 1, en que el epítopo de linfocitos T colaboradores es la secuencia de aminoácidos LSEIKGVIVHRLEGV.

3. El péptido quimérico según la reivindicación 1 o 2, en que el conectar es Gly-Pro-Ser-Leu.

4. El péptido quimérico según una de las reivindicaciones 1 a 3, el cual tiene una longitud de 35 hasta 15 aminoácidos.

5. Una composición inmunogénica que comprende el péptido quimérico según una de las reivindicaciones 1 a 3 y al menos un vehículo farmacológicamente aceptable.

6. Un polinucleótido que codifica el péptido quimérico según una de las reivindicaciones 1 a 4.


 

Patentes similares o relacionadas:

Neuregulina para tratar la insuficiencia cardíaca, del 29 de Julio de 2020, de Zensun (Shanghai) Science & Technology, Co., Ltd: Neuregulina para usar en un método para tratar la insuficiencia cardíaca crónica en un paciente, donde el paciente tiene un nivel plasmático de NT-proBNP […]

Dispositivo médico que tiene un revestimiento que comprende ACCS, del 15 de Julio de 2020, de Noveome Biotherapeutics, Inc: Un dispositivo médico implantable que tiene un revestimiento en su superficie, útil para la implantación quirúrgica en el cuerpo de un sujeto, […]

Composiciones que comprenden cócteles de fagos antibacterianos y usos de las mismas para el tratamiento de infecciones bacterianas, del 24 de Junio de 2020, de Tecnifar-Indústria Técnica Farmacêutica, S.A: Una composicion que comprende: una primera y una segunda cepa purificada de bacteriofago, cada una de dichas cepas que tiene un genoma que comprende […]

Trampas de GDF, del 3 de Junio de 2020, de ACCELERON PHARMA, INC: Un polipéptido aislado que comprende la secuencia de aminoácidos de SEQ ID NO: 28.

Combinacion de peptidos tolerogenos con TFG-â para inducir y mantener la tolerancia oral en mamiferos jovenes, del 3 de Junio de 2020, de SOCIETE DES PRODUITS NESTLE S.A.: Una composición nutricional - que contiene al menos un péptido de cinco hasta doce aminoácidos de longitud e incluye una secuencia elegida entre […]

Formulaciones con oxidación reducida, del 3 de Junio de 2020, de F. HOFFMANN-LA ROCHE AG: Una formulación líquida que comprende un anticuerpo y un compuesto que previene la oxidación del anticuerpo en la formulación líquida, en la que el compuesto es […]

Modulación de la actividad del factor de crecimiento epidérmico de unión a heparina para la curación de la membrana timpánica, del 6 de Mayo de 2020, de THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY: Un agente que proporciona actividad de factor de crecimiento epidérmico de unión a heparina (HB-EGF) para su uso en el tratamiento de una perforación crónica de la membrana […]

Composiciones para lograr niveles plasmáticos deseados del factor 2 de crecimiento glial, del 6 de Mayo de 2020, de ACORDA THERAPEUTICS, INC: Factor de crecimiento glial 2 (GGF2) para su uso en la promocion de la remielinizacion celular en un paciente, donde el GGF2 se administra al paciente en una cantidad de […]

Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .