Péptidos de cambio de marco (FSP) específicos de MSI para prevención y tratamiento del cáncer.

Una vacuna que contiene una combinación de péptidos de cambio de marco (FSP) específicos de MSI que comprende las secuencias de aminoácidos siguientes:



NTQIKALNRGLKKKTILKKAGIGMCVKVSSIFFINKQKP (TAF1B (-1));

EIFLPKGRSNSKKKGRRNRIPAVLRTEGEPLHTPSVGMRETTGLGC (HT001 (-1)); y

HSTIKVIKAKKKHREVKRTNSSQLV (AIM2 (-1)).

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E11007684.

Solicitante: Ruprecht-Karls-Universität Heidelberg.

Nacionalidad solicitante: Alemania.

Dirección: GRABENGASSE 1 69117 HEIDELBERG ALEMANIA.

Inventor/es: KLOOR,MATTHIAS,DR, REUSCHENBACH,MIRIAM, KNEBEL-DOEBERITZ,MAGNUS.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/00 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

PDF original: ES-2548391_T3.pdf

 


Fragmento de la descripción:

Péptidos de cambio de marco (FSP) específicos de MSI para prevención y tratamiento del cáncer

La presente invención proporciona una vacuna para prevención y tratamiento del cáncer caracterizada por inestabilidad de microsatélites (MSI). La vacuna contiene una combinación de péptidos de cambio de marco (FSP) específicos de MSI que generan respuestas humorales y celulares contra las células tumorales o un ácido nucleico que codifica dichos FSP.

Los tumores humanos se desarrollan por dos caminos principales de inestabilidad del genoma, inestabilidad cromosómica e inestabilidad de microsatélites (MSI) que es resultado de defectos en el sistema de reparación de errores del DNA. La MSI se encuentra en el 15% de los cánceres colorrectales y una diversidad de enfermedades malignas extracolónicas que presentan un sistema deficiente de reparación de errores del DNA, con inclusión de cánceres endometriales, cánceres gástricos, cánceres del intestino delgado y tumores de otros órganos. Los cánceres MSI pueden desarrollarse esporádicamente o en el contexto de un síndrome tumoral hereditario, cáncer colorrectal hereditario distinto de poliposis (FINPCC) o síndrome de Lynch.

Los cánceres MSI colorrectales se caracterizan por una alta inmunogenicidad que es resultado de la generación de numerosos péptidos de cambio de marco (FSP) durante el desarrollo de tumores MSI como resultado directo de la deficiencia en la reparación de errores, lo que conduce a alteraciones de marco de lectura de la traducción cuando los microsatélites de las regiones codificantes de genes se ven afectados por mutación (Figura 1).

La abundancia de antígenos FSP predecibles específicos de MSI y el hecho de que los mismos son resultado directo del proceso de transformación maligna hacen que los FSP sean dianas muy prometedoras para terapia inmune. Se cree que el sistema inmune humano es un recurso potencial para erradicar las células tumorales y que puede desarrollarse un tratamiento eficaz si los componentes del sistema inmune se estimulan adecuadamente para reconocer y eliminar las células del cáncer. Así, la inmunoterapia, que comprende composiciones y métodos para activar el sistema inmune del cuerpo, directa o indirectamente, para contraer o erradicar el cáncer, ha sido estudiada desde hace muchos años como adyuvante para la terapia convencional del cáncer.

WO 03/087162-A2 da a conocer vacunas preventivas y terapéuticas que implican FSP, dirigidas entre otras cosas al tratamiento de HPNCC.

Está admitido generalmente que el crecimiento y la metástasis de los tumores depende en gran parte de su capacidad para evadirse de la vigilancia inmune del hospedador. La mayoría de los tumores expresan antígenos que pueden ser reconocidos en una proporción variable por el sistema inmune del hospedador, pero en muchos casos, la respuesta inmune es inadecuada. El fracaso en la provocación de una activación fuerte de las células T efectoras puede ser resultado de la inmunogenicidad débil de los antígenos tumorales o la expresión inadecuada o ausente de moléculas co-estimulantes por las células tumorales. Para la mayoría de las células T, la producción de IL-2 y la proliferación requieren una señal co-estimulante simultánea con la entrada en acción del TCR; en caso contrario, las células T pueden entrar en un estado funcionalmente insensible, conocido como anergia clonal.

A pesar del largo tiempo durante el que se han investigado estas terapias, persiste la necesidad de estrategias mejoradas para aumentar la respuesta inmune contra los antígenos tumorales.

No obstante, existe necesidad en la técnica de composiciones seguras y eficaces que puedan estimular el sistema inmune como inmunoterapia del cáncer.

Conforme a la invención, una estimulación segura y eficaz del sistema inmune como inmunoterapia del cáncer se consigue por las materias que constituyen el objeto definido en las reivindicaciones. Datos in vitro han demostrado que los FSP son sumamente inmunógenos y pueden provocar in vitro respuestas pronunciadas de las células T específicas de FSP (Linnebacher et al. 2001, Ripberger et al. 2003, Schwitalle et al. 2004). En estudios ulteriores en los que se examinó sangre periférica extraída de pacientes con cáncer de colon MSI, se demostró una alta frecuencia de respuestas de células T específicas de FSP (Schwitalle et al. 2008). A pesar del elevado número de células T específicas de FSP en el tumor y en la sangre periférica, estos pacientes no demostraban signo alguno de autoinmunidad, lo que sugería que no es de esperar que los enfoques de vacunación FSP tengan efectos secundarios en términos de autoinmunidad.

Los análisis inmunológicos en individuos portadores de una mutación de la línea germinal en los genes de reparación de errores del DNA que predisponen a cáncer colorrectal hereditario distinto de la poliposis (HNPCC) se encontró también que exhiben respuestas inmunes celulares contra FSP, incluso en ausencia de un tumor clínicamente detectable. Esto sugiere que las respuestas inmunes específicas de FSP pueden ser protectoras en individuos con HNPCC, lo que sugiere que la vacunación FSP puede utilizarse también en un escenario preventivo como el primer enfoque de prevención específico en una condición de cáncer heredada.

En resumen:

(a) los péptidos de cambio de marco (FSP) son específicos de MSI y son resultado directo de la patogénesis de tumores MSI;

(b) no son de esperar efectos secundarios clínicamente relevantes;

(c) se predice que las combinaciones de FSPs se dlrecclonarán a todos los tumores con MSI;

(d) se ha designado la vacunación con FSP para terapia del 15% de los cánceres de colon y tumores del endometrio, estómago, intestino delgado y otros órganos;

(e) el análisis molecular de los tumores puede identificar pacientes que puedan beneficiarse de la vacunación

con FSP (terapia direccionada); y

(f) la vacunación con FSP puede utilizarse como vacunación preventiva en grupos de alto riesgo.

Breve descripción de los dibujos

Figura 1: Ilustración esquemática de inestabilidad de microsatélites codificantes resultante de la deficiencia en la reparación de errores del DNA fKloor et al.. 20101

Proteínas truncadas que abarcan secuencias de FSP (rojo) se generan cuando las mutaciones de microsatélites codificantes conducen a alteraciones de marco de lectura de la traducción (ejemplo: la proteína TGFBR2).

Figura 2: Respuestas de células T ilustrativas contra FSPs de nuevo diseño en sanare periférica de tres pacientes con cáncer de colon MSI

Figura 3: Las respuestas inmunes humorales contra FSPs derivados deAIM2 1-11. HT001 1-1). TAF1B MI v TGFBR2 M)

ELISA reveló respuestas de anticuerpos específicos de FSP dirigidas contra neopéptidos derivados de AIM2 (-1), HT001 (-1), TAF1B (-1), y TGFBR2 (-1). La especificidad de péptidos se demostró por preabsorción de los anticuerpos del suero respectivos como se ha descrito previamente (Reuschenbach et al., 2008).

Figura 4: Respuestas citotóxicas como se determinan por la expresión en la superficie de CD107a

(A) Se observaron respuestas específicas importantes de FSP en diferentes donantes sanos después de estimulación de las células T con el antígeno durante 4 semanas. Las respuestas ocurrían solo en presencia de células B presentadoras de antígeno y el antígeno FSP. Las respuestas representativas se muestran en gráficos de barras.

(B) Análisis FACS representativos del ensayo de CD107a para células T incubadas con células B como células presentadoras de antígeno en ausencia (panel izquierdo) o presencia (panel derecho) del antígeno FSP HT001 (-1).

Así pues, la presente invención proporciona una vacuna que contiene una combinación de péptidos de cambio de marco (FSP) específicos de tumor MSI, derivados de TAF1B (Acc. No. L39061), HT001 (Acc. No. AF113539) y AIM2 (Acc. No. AF024714), y, opcionalmente, además de TGFBR2 (Acc. No. NM_003242) o un ácido nucleico que codifica dicho FSP en el que dichos FSP son capaces de suscitar una respuesta inmune contra el cáncer que exhibe MSI.

La vacuna de la presente invención contiene una combinación de FSP que comprende o está constituida por las secuencias de aminoácidos siguientes:

NTQIKALNRGLKKKTILKKAGIGMCVKVSSIFFINKQKP (TAF1 B(-1)); EIFLPKGRSNSKKKGRRNRIPAVLRTEGEPLHTPSVGMRETTGLGCIHT001M11: HSTIKVIKAKKKHREVKRTNSSQLV (AIM2(-1)); y, opcionalmente, además

ASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKNITPAILTCC UGFBR2M11.

Una respuesta inmune se define como una condición que satisface al menos uno de los criterios siguientes: 1. La inducción de células T CD8-positivas, como puede detectarse... [Seguir leyendo]

 


Reivindicaciones:

1. Una vacuna que contiene una combinación de péptidos de cambio de marco (FSP) específicos de MSI que comprende las secuencias de aminoácidos siguientes:

NTQIKALNRGLKKKTILKKAGIGMCVKVSSIFFINKQKP (TAF1B (-1)); EIFLPKGRSNSKKKGRRNRIPAVLRTEGEPLHTPSVGMRETTGI GC (HTOOI (-1)); y HSTIKVIKAKKKHREVKRTNSSQLV (AIM2 (-1)).

2. La vacuna de la reivindicación 1, que contiene adicionalmente un FSP que comprende la secuencia de aminoácidos siguiente:

ASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKNITPAILTCC (TGFBR2 (-1)).

3. La vacuna de la reivindicación 1 ó 2, en donde el FSP contiene adicionalmente una secuencia Tag.

4. Una vacuna que contiene (i) las secuencias de ácido nucleico que codifican el FSP de una cualquiera de las reivindicaciones 1 a 3 o (ii) vector(es) que contiene(n) dichas secuencias de ácido nucleico.

5. La vacuna de la reivindicación 4, en la cual dicho vector es un plásmido o vector viral.

6. La vacuna de la reivindicación 5, en la cual dicho vector viral es un vector basado en poxvirus, adenovirus, retrovirus, herpesvirus, alfavirus o virus adenoasociado (AAV).

7. La vacuna de la reivindicación 6, en la cual dicho poxvirus es un virus Vaccinia, NYVAC, avipoxvirus, canarypox virus, ALVAC, ALVAC(2), poxvirus de las aves o TROVAC.

8. La vacuna de una cualquiera de las reivindicaciones 1 a 7 que comprende adicionalmente una citocina o quimiocina adyuvante y/o inmunoestimuladora.

9. La vacuna de una cualquiera de las reivindicaciones 1 a 8, en la cual el compuesto activo está presente en un vehículo de emulsión de aceite en agua o de agua en aceite.

10. La vacuna de una cualquiera de las reivindicaciones 1 a 9 que comprende adicionalmente uno o más antígenos distintos.

11. La vacuna de una cualquiera de las reivindicaciones 1 a 10 para uso en un método para la prevención o tratamiento de un tumor.

12. Uso de los péptidos de cambio de marco (FSP) específicos de tumor MSI que se definen en una cualquiera de las reivindicaciones 1 a 3, el ácido nucleico que se define en la reivindicación 4, o el vector que se define en una cualquiera de las reivindicaciones 4 a 7 para la preparación de una vacuna para la prevención o el tratamiento de un tumor.

13. La vacuna de cualquiera de las reivindicaciones 1-11 para el uso de la reivindicación 11 ó 12 por vacunación preventiva de grupos de alto riesgo.

14. La vacuna de cualquiera de las reivindicaciones 1-11 para el uso conforme a una cualquiera de las reivindicaciones 11 a 13, en la cual el tumor es cáncer colorrectal, cáncer endometrial, cáncer gástrico o cáncer de intestino delgado.

15. La vacuna de cualquiera de las reivindicaciones 1-11 para el uso conforme a la reivindicación 14, en la cual el cáncer colorrectal es cáncer colorrectal hereditario distinto de poliposis (HNPCC).


 

Patentes similares o relacionadas:

Procedimientos y composiciones de la pirrolisina, del 8 de Mayo de 2019, de Zoetis Services LLC: Un procedimiento para aumentar el rendimiento de la pirrolisina producida por Trueperella pyogenes, en el que el procedimiento comprende: A) cultivar T. pyogenes […]

Regiones epítopo de un receptor de tirotropina (TSH), sus usos y anticuerpos para las mismas, del 8 de Mayo de 2019, de RSR LIMITED: Un kit para la detección de autoanticuerpos para un receptor de TSH en una muestra de fluido corporal obtenida de un sujeto que se sospecha que padece, es susceptible […]

Receptores de linfocitos T, del 8 de Mayo de 2019, de Adaptimmune Limited: Un receptor de linfocitos T (RLC) de origen no natural y/o purificado y/o modificado por ingeniería genética, que tiene la propiedad de unirse […]

Péptidos KNTC2 y vacunas que los contienen, del 8 de Mayo de 2019, de ONCOTHERAPY SCIENCE, INC.: Un péptido aislado de menos de 15 aminoácidos que tiene la capacidad de inducir un linfocito(s) T citotóxico (CTL), en donde el péptido comprende una secuencia de […]

Formulaciones de adyuvante mejoradas que comprenden agonistas de TLR4 y métodos para usar las mismas, del 8 de Mayo de 2019, de INFECTIOUS DISEASE RESEARCH INSTITUTE: Una emulsión de aceite en agua que comprende un agonista de TLR4 y un aceite metabolizable, en donde el aceite metabolizable está presente en la […]

Vacunas de células dendríticas para tumores que expresan asparaginil-beta-hidroxilasa, del 6 de Mayo de 2019, de RHODE ISLAND HOSPITAL: Una célula dendrítica cargada con aspartil (asparaginil)-ß-hidroxilasa (AAH) madura aislada para su uso en un método de tratamiento de un tumor que […]

Vacunas de filovirus basadas en un vector adenovírico de chimpancé, del 6 de Mayo de 2019, de THE GOVERNMENT OF THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY OF THE DEPARTMENT OF HEALTH AND HUMAN SERVICES: Un vector de adenovirus de chimpancé recombinante de serotipo ChAd3 que comprende un ácido nucleico que codifica una glicoproteína del virus Ébola, o una composición […]

Anticuerpos biespecíficos contra IL-17A/F IL-23 y sus usos, del 6 de Mayo de 2019, de BRISTOL-MYERS SQUIBB COMPANY: Un anticuerpo biespecífico que comprende una entidad de fijación a IL-17A/F y una entidad de fijación a IL-23, en el que la entidad de fijación a IL-17A/F […]

Otras patentes de Ruprecht-Karls-Universität Heidelberg

 

Otras patentes de la CIP A61K39/00