1,449 Patentes de octubre de 2012 (pag. 9)

  1. 257.-

    PROCEDIMIENTO PARA LA OBTENCIÓN DE UN TEJIDO FLOCADO

    (10/2012)

    Un procedimiento para obtener un tejido flocado que proporciona un producto final con un flocado incrustado, pudiendo el flocado incluir figuras/dibujos previamente establecidos. El procedimiento prevé que en la fase de aplicación de los filamentos de fibras sintéticas, se incorpore una malla intermedia, por gravedad y sin ejercer presión alguna para que el adhesivo no supere el espesor de los hilos de la malla y las fibras sintéticas se adhieran al adhesivo únicamente a través de las aberturas o intersticios de la...

  2. 258.-

    AMPLIFICADOR PARA VARIADOR DE FRECUENCIA

    (10/2012)

    Variador de frecuencia. La presente invención propone un variador de frecuencia para motor eléctrico. Este variador se caracteriza por el hecho de que comprende una neurona artificial por cada fase del motor, donde una de sus entradas es una primera señal de síntesis generada por una unidad de control y procesado digital con salidas analógicas, y su salida está conectada al motor.

  3. 259.-

    SISTEMA AUTOMÁTICO DE CALIBRACIÓN DE HELIÓSTATOS DE PLANTA TERMOSOLAR TIPO TORRE

    (10/2012)

    El dispositivo de la invención está ideado a calibrar por la noche y utilizando un emisor artificial de luz (diseñado para tal efecto) los heliostatos de una planta termo-solar de tipo torre, es decir con el dispositivo se podrá realizar los ajustes de las unidades automáticamente (por visión artificial) y cuando todos los heliostatos están en reposo (sin producir). Con la ayuda de una emisión lumínica desde la parte inferior de la torre (proyección laser), se emite un haz de luz sobre el heliostato a ajustar,...

  4. 260.-

    AERONAVE DE PASAJEROS COMPUESTA EN DOS AVIONES INDEPENDIENTES, COMO SISTEMA DE SEGURIDAD Y TRANSPORTE

    (10/2012)

    La siguiente invención se refiere a una aeronave de pasajeros formada por dos aviones independientes que se corresponden y trabajan conjuntamente, siendo un avión con el habitáculo de pasajeros, acoplado, a la parte superior de otro avión con el resto de compartimientos, y en ambos, sus formas y dimensiones junto a la disposición de sus elementos de vuelo se comprenden entre sí para formar la aeronave. Esta aeronave podrá proceder a la maniobra de despegue de su avión con los pasajeros sobre en el que se acopla...

  5. 261.-

    PROCEDIMIENTO DE REPARACIÓN DEL SISTEMA DE FRENADO DEL MECANISMO DE ORIENTACIÓN RELATIVA ENTRE LA GÓNDOLA Y LA TORRE DE UNA TURBINA EÓLICA

    (10/2012)

    Procedimiento de reparación del sistema de frenado del mecanismo de orientación relativa entre la góndola y la torre de una turbina eólica. Permite reparar mediante mecanizado la superficie de frenado sin necesidad de desmontar la góndola. El procedimiento comprende la etapa de montar una herramienta de mecanizado solidariamente a un elemento de frenado , en una posición que permite mecanizar la superficie de frenado durante el accionamiento simultáneo de dicha herramienta , por medio de unos medios de...

  6. 262.-

    Sistema de detección de vida útil de lámparas de descarga

    (10/2012)

    Sistema de detección de vida útil de lámparas de descarga, especialmente de aquéllas cuya vida media sea relativamente larga (de 2 a 5 años), de forma que se pueda determinar con garantías el tiempo de vida útil remanente de las mismas basado en, una vez establecidos los criterios de aceptación y rechazo de una lámpara, estudiar preferentemente de manera diaria el incremento de resistencia respecto a su valor al comienzo de su vida útil, a temperatura constante y eliminando la influencia en la medición del...

  7. 263.-

    EXTENSIÓN PARA EL CABELLO Y MÉTODO PARA SU APLICACIÓN

    (10/2012)

    Extensión para el cabello y método para su aplicación. La extensión comprende una pluralidad de cabellos unidos por uno sus extremos, conformando dicho extremo la zona de unión de la extensión al cabello del usuario; y una lámina flexible de material plástico conformante de un soporte de la extensión. Los extremos de los cabellos de la extensión, destinados a fijarse sobre dicha lámina flexible se encuentran superpuestos sobre una de las caras de la mencionada lámina flexible y fijadas a la misma mediante...

  8. 264.-

    PROCEDIMIENTO DE PREPARACIÓN, CONSERVACIÓN, Y USO EN PECES, DEL PROBIÓTICO SHEWANELLA PUTREFACIENS PDP 11 PARA EL CONTROL DE ENFERMEDADES Y LA MEJORA EN EL CRECIMIENTO

    (10/2012)

    Procedimiento de preparación, conservación, y uso en peces, del probiótico Shewanella putresfaciens Pdp11 para el control de enfermedades y la mejora en el crecimiento. Preferentemente, el probiótico, compuesto por células enteras de la cepa Pdp11, se cultiva en TSAs durante 24 h a 22ºC. La preparación de una suspensión del probiótico, preferentemente sin proceso previo de liofilización o de inactivación física o química, se realiza mediante su incorporación en una matriz de alginato, preferentemente alginato...

  9. 265.-

    MÉTODO PARA PREPARAR UN LIOFILIZADO DE CRUSTÁCEOS CAPRÉLIDOS (CAPRELLA SSP)

    (10/2012)

    La presente invención tiene por objeto un método para preparar un liofilizado de crustáceos caprélidos Caprella spp que comprende las etapas de recolección, congelación y liofilización. Se obtiene así un producto natural, rico en proteínas, ácidos grasos Omega-3 y calcio. La invención pertenece al sector técnico de la acuariofilia y/o acuicultura pues se propone su uso como alimento base o complemento nutricional en la alimentación de peces y otros animales tanto ornamentales como de interés para consumo....

  10. 266.-

    COMPOSICIÓN SINTÉTICA CON EFECTO XEROPROTECTOR

    (10/2012)

    La presente invención se refiere a una composición xeroprotectora sintética, similar a la que puede obtenerse a partir del microorganismo de la especie bacteriana Microbacterium sp. con número de acceso CECT7624 que comprende trehalosa, ácido oxoglucurónico, lactato, glutamato, glutamina y piruvato, o además comprende fucosa. La presente invención también se refiere al uso de la composición xeroprotectora para la conservación de material biológico y a un método para la conservación de dicho material...

  11. 267.-

    COMPOSICIÓN SINTÉTICA CON EFECTO XEROPROTECTOR

    (10/2012)

    Composición sintética con efecto xeroprotector. La presente invención se refiere a una composición xeroprotectora sintética, similar a la que puede obtenerse a partir del microorganismo de la especie bacteriana Rhodococcus sp. con número de acceso CECT7625, que comprende acetato, lactato, ácido glutámico, {be}-hidroxibutirato y fructosa. La presente invención también se refiere al uso de la composición xeroprotectora para la conservación de material biológico con un contenido de humedad residual igual...

  12. 268.-

    ENVASE CON VARIAS APERTURAS

    (10/2012)

    Envase con varias aperturas. El envase dispone de un cuerpo principal dotado de unos primeros medios cierre hermético que comunican con un primer volumen interno del cuerpo en el que está envasado un primer producto; encontrándose separado herméticamente ese primer volumen respecto de al menos un volumen interno adicional mediante al menos un tabique interno separador ; presentando cada volumen interno adicional un medio de cierre hermético adicional (9') y un producto envasado seleccionado entre dicho...

  13. 269.-

    kit para la terapia del cáncer y composición farmacéutica para la terapia del cáncer

    (10/2012)

    Un kit para uso en el tratamiento del cáncer que comprende una combinación de dos fármacos diferentesen una formulación de kit, en el que un primer fármaco contiene un retinoide sintético representado por la siguientefórmula (I): o una sal de adición de ácido orgánico o inorgánico farmacéuticamente aceptable del mismo, y un segundo fármacoque contiene un agente quimioterapéutico para el tratamiento del cáncer seleccionado de un grupo que consiste enprednisolona, ácido arsenioso, 5-aza-2'-desoxicitidina, melfalán, dexametasona, y ácido valproico.

  14. 270.-

    Reconstrucción de vistas desentrelazadas, utilizando interpolación adaptativa basada en disparidades entre las vistas para un muestro ascendente

    (10/2012)

    Un método, que comprende las etapas de: recibir un flujo de datos que contiene vistas de canal izquierdo y derecho entrelazadas de un flujo de vídeo 3D,desentrelazar el flujo de vídeo 3D para extraer las vistas de canal izquierdo y derecho,muestrear de manera ascendente las vistas de canal izquierdo y derecho, que comprende: determinar una cantidad de disparidad entre las vistas de canal izquierdo y derecho en una ubicación de píxel oen una región correspondiente a la ubicación de píxel; y caracterizado por: seleccionar al menos un filtro de entre un conjunto de filtros parainterpolar un valor de píxel que falta en la ubicación de píxel en una de las vistas de canal izquierdo y derecho,donde...

  15. 271.-

    Caja de aparato electrodoméstico de preparación culinaria provisto de un alojamiento para el almacenamiento del cable

    (10/2012)

    Caja de aparato electrodoméstico de preparación culinaria, tal como una batidora de mano, incluyendodicha caja un cuerpo que contiene un órgano eléctrico alimentado por un cable eléctrico, el cuerpo de lacaja incluye un alojamiento para el almacenamiento del cable incluyendo un núcleo alrededor del cual el cable puede ser enrollado, caracterizado porque dicho alojamiento incluye una falda de material flexible elástico,dispuesta en la prolongación del cuerpo de la caja y que oculta al menos parcialmente el núcleo , dicha falda presenta una forma adaptada que permite su volteo en una posición estable liberando el acceso al alojamiento.

  16. 272.-

    Escuadra de apoyo con paso de conducción

    (10/2012)

    Escuadra de apoyo con un brazo de apoyo y un casquillo de apoyo acodado del brazo de apoyo ,que rodea un paso de conducción , que comprende una clavija de apoyo formada como una pieza junto con elbrazo de apoyo y acodada del brazo de apoyo en dirección longitudinal del casquillo de apoyo ,estando acodada la clavija de apoyo en dirección longitudinal del casquillo de apoyo del brazo de apoyo , caracterizada por que el brazo de apoyo junto con la clavija de apoyo está formado a partir de un recortede material plano, terminando el paso de conducción a la altura de una superficie del brazo de apoyo orientada hacia la clavija de apoyo , de tal manera que un cable eléctrico se puede...

  17. 273.-

    Impresora con una cabeza de exposición

    (10/2012)

    Impresora, en particular impresora en serie, con una cabeza de exposición para la exposición de imágenes aimprimir y una carcasa de la cabeza de exposición en la que está dispuesta una lámpara rodeada al menosen parte por reflectores , que durante el funcionamiento emite una radiación, que seconduce mediante los reflectores a un plano de imágenes en el que puedeimprimirse con tinta endurecible a la luz, estando montados reflectores elípticos así como reflectoresplanos en la carcasa de la cabeza de exposición, estando posicionada la lámpara en unprimer foco de los reflectores elípticos y estando dispuestos los reflectores elípticos , lalámpara y el plano de impresión de...

  18. 274.-

    Policarbonatos con oligómeros cíclicos y comportamiento de fluencia mejorado

    (10/2012)

    Policarbonato con una o varias estructuras de las fórmulas generales (II) a (V) en las que los anillos de fenilo pueden estar substituidos independientemente entre sí una o dos veces con substituyentes seleccionados entre alquilo C1-C8 y halógeno, y X representa un enlace sencillo, alquileno C1 a C6, alquilideno C2 a C5 o cicloalquilideno C5 a C6, que puede estar substituido con alquilo C1 a C4, ascendiendo la cantidad de las unidades estructurales (II) a (V) en suma a 50 a 1210 ppm referida al policarbonato de base, que contiene de 0,3 a 1% en peso referido a toda la composición de oligómeros cíclicos de fórmula general (I) en el que los ciclos contenidos presentan en...

  19. 275.-

    Inhibidores de la proteína quinasa bicíclicos

    (10/2012)

    Un compuesto de Fórmula I: o una sal farmacéuticamente aceptable del mismo, en la que: R1 es -OR4, -NR4R5, -C(≥O)R4, -CO2R4, -CONR4R5, -NO2, -CN, -S(O)j1R4, -SO 2NR4R5, -NR4C(≥O)R5, -NR4C(≥O)OR5, -NR4C(≥O)NR5R5a, -NR4S(O)j1R5, -C(≥S)OR4, -C(≥O)SR4, -NR4C(≥NR5)NR4aR5a, -NR4C(≥NR5)OR4a, -NR4C(≥NR5)SR4a, -OC(≥O)OR5, -OC(≥O)NR4R5, -OC(≥O)SR4, -SC(≥O)OR4 o -SC(≥O)NR4R5;cada uno de R2 y R3 es hidrógeno; X1 es -C-E1; X2 es -C-E1; X3 y X5 son N o -N-(E1)aa cada uno de X4, X6 y X7 es C; Q1 aril-alquilo C0-10, aril-alquenilo C2-10, aril-alquinilo C2-10, hetaril-alquilo C0-10, hetaril-alquenilo C2-10 o hetarilalquiniloC2-10, cualquiera...

  20. 276.-

    Etiqueta RFID

    (10/2012)

    Etiqueta RFID con una etiqueta de diseño textil, en cuyo lado trasero está dispuesto un transpondedorque presenta un chip provisto de una antena (12, 12a, 12b), presentando la etiqueta RFID una capa textil subdividida en dos secciones a lo largo de una línea de plegado , estando configurada la primera sección como etiqueta de diseño, sobre la que está plegada la segunda sección que está configurada como etiquetatranspondedora, caracterizada porque la segunda sección contiene una antena incorporada (12, 12a, 12b) queestá unida al chip y porque la capa textil está tricotada o tejida, estando la antena tricotada o tejida

  21. 277.-

    Mezcla de sales de hierro y de cobre para enmascarar el sabor metálico

    (10/2012)

    Complemento nutricional oral que comprende una fuente de hierro que es pirofosfato férrico y citrato de cobrecomo fuente de cobre, en el que la fuente de hierro es un pirofosfato férrico anhidro, el monohidrato o elnonahidrato de pirofosfato férrico.

  22. 278.-

    Método y aparato de unir tuberías para producir tuberías subacuáticas, y buque de tendido de tuberías subacuáticas incluyendo dicho aparato

    (10/2012)

    Un método de unir tuberías para producir una tubería subacuática , incluyendo el método soldar losextremos libres opuestos de dos tuberías adyacentes , alineados a lo largo de un eje (A), para definir unareducción ; y enrollar una hoja protectora alrededor de la reducción ; y extrudir la hoja protectora cerca de la reducción desde una salida de extrusión que mira y está cerca de la reducción por unextrusor y enrollar la hoja protectora alrededor de la reducción simultáneamente; caracterizándose elmétodo por girar el extrusor y la salida de extrusión alrededor del eje (A), y mantener la salida de extrusión mirando y cerca de la reducción con...

  23. 279.-

    2-[4-(Pirazol-4-ilalquil)piperazin-1-il]-3-fenil pirazinas y piridinas y 3-[4-(pirazol-4-ilalquil)piperazin-1-il]-2-fenil piridinas como antagonistas del receptor de 5-HT7

    (10/2012)

    Un compuesto de la fórmula: en la que: Cada uno de A y B es independientemente -C(H)≥ o -N≥, con la condición de que al menos uno de A y B sea -N≥;n es 1, 2 ó 3; m es 0, 1, 2 ó 3; R1 se selecciona entre el grupo que consiste en i) hidrógeno, ii) alquilo (C1-C6)- opcionalmente sustituido con hidroxi, ciano o 1 a 5 sustituyentes de flúor, o comoalternativa, opcionalmente sustituido con hidroxi y 1 a 3 sustituyentes de flúor, iii) cicloalquil (C3-C7)-alquilo(C0-C2)- opcionalmente sustituido con hidroxi, iv) alquil (C1-C2)-O-alquilo (C1-C2)-, v) Ph1-alquilo (C0-C2)-, vi)Ar1-alquilo (C0-C2)-, vii) alquil (C1-C2)-S(O)2-alquilo (C0-C3)-, viii) Ph1-S(O)2-, ix) Ar1-S(O)2-,...

  24. 280.-

    Materiales compuestos textiles no tejidos extensibles variables y multicapa

    (10/2012)

    Un material compuesto textil no tejido multicapa preparado formando las capas de dicho material compuesto enuna dirección de mecanizado, comprendiendo dicho material compuesto textil no tejido multicapa: a) al menos una capa interna que comprende fibras sopladas en estado fundido; y b) al menos una capa externa que comprende fibras de filamento continuo de napa de hilatura, estandodispuesta dicha al menos una capa externa sobre un lado de dicha al menos una capa interna; en el que las fibras de napa de hilatura en dicha al menos una capa externa comprenden diferentes fibras formadasa partir de al menos dos tipos diferentes de material polimérico; y en el que dichas fibras...

  25. 281.-

    Tensor de bordón

    (10/2012)

    Tensor de bordón que incluye un primer tensor y un segundo tensor , que están adaptados para fijarse auna superficie circunferencial exterior de un cilindro de tambor de un tambor de bordón en posiciones opuestas yadaptados para controlar un conjunto de bordón que incluye bordones para moverse en estrecho contacto con, osepararse de un parche del tambor del tambor de bordón, en el que dicho primer tensor comprende unelemento de sujeción adaptado para sujetar un elemento de conexión de bordón unido a un extremo prescritodel conjunto de bordón, caracterizado porque dicho primer tensor también comprende una varilla de estirado que se proporciona de manera amovible y está...

  26. 282.-

    Unidad interior de un acondicionador de aire

    (10/2012)

    Una unidad interior de un acondicionador de aire que comprende un cuerpo que incluye un intercambiadorde calor y un conjunto de ventiladores y que realiza el enfriamiento o calentamiento, y un panel frontal provisto deuna superficie frontal del cuerpo, la unidad interior comprende además: un dispositivo de visualización montado en el panel frontal, en el que el dispositivo de visualizacióncomprende un conjunto de visualización que incluye una pantalla táctil que permite laintroducción de una condición de funcionamiento del cuerpo y una cubierta de la pantalla que recibeel conjunto de visualización; un conector del dispositivo externo montado en la cubierta de...

  27. 283.-

    Anticuerpos híbridos anti- integrina alfa V modificados genéticamente

    (10/2012)

    Un anticuerpo híbrido anti- integrina αv recombinante modificado genéticamente, que comprende (i) las regiones CDR de la cadena liviana: CDR1 : RASQDISNYLA CDR2: YTSKIHS CDR3: QQGNTFPYT (ii) las regiones CDR de la cadena pesada: CDR1: SFWMH, CDR2: YINPRSGYTEYNEIFRD, CDR3: FLGRGAMDY; (iii) las regiones armazón de la cadena liviana: FR-1: DIQMTQSPSSLSASVGDRVTITC, FR-2: WYQQKPGKAPKLLIY FR-3: GVPSRFSGSGSGTDYTFTISSLQPEDIATYYC FR-4: FGQGTKVEIK (iv) las regiones armazón de la cadena pesada FR1: QVQLQQSGAELAEPGASVKMSCKASGYTFS FR2: WVKQRPGQGLEWIG FR3: KATMTADTSSSTAYMQLSGLTSEDSAVYYCAS FR4: WGQGTSVTVSS y (v) una región constante de la...

  28. 284.-

    Bomba alternativa con válvula de aire monitorizada electrónicamente y pistón

    (10/2012)

    Una bomba accionada por aire que tiene una válvula de aire con un asiento de la válvula y una tapa dela válvula { 2 2 ) , comprendiendo la bomba: un imán montado en dicho asiento de la válvula de dicha válvula de aire; y primer y segundo detectores de lengüeta montados en la tapa de la válvula para monitorizar la velocidad y laposición del asiento de válvula .

  29. 285.-

    IMIDAZOL (1,2-A)PIRIDINAS y compuestos relacionados con actividad frente a los receptores cannabinoides CB2

    (10/2012)

    Un compuesto de Fórmula I: **Fórmula** o una sal farmacéuticamente aceptable del mismo, en la que:**Fórmula** a) el resto se selecciona entre el grupo que consiste en**Fórmula**

  30. 286.-

    Procedimiento y dispositivo para sellar una lámina desgarrable sobre un elemento de embalaje

    (10/2012)

    Procedimiento para formar una costura de sellado entre una lámina desgarrable , la cual está provista de unalengüeta de desgarre, y un elemento de embalaje , el cual comprende por lo menos una etapa de sellado, en lacual el elemento de embalaje y la lámina son comprimidos entre una herramienta inferior , que aloja elelemento de embalaje , y una herramienta superior , de tal manera que en las zonas de borde de la lámina y del elemento de embalaje se forme una costura de sellado perimetral, siendo la costura de sellado parcialmente destruida o debilitada por su borde interior en la zona de una lengüeta de desgarre duranteuna etapa de sellado o en una etapa posterior sin sellado, caracterizado...

  31. 287.-

    Derivados de 2-oxi benzoxazinona para el tratamiento de la obesidad

    (10/2012)

    El uso de un compuesto que comprende la **fórmula** o una sal farmacéuticamente aceptable, éster o amida del mismo; en la fabricación de un medicamento para el tratamiento de afecciones que requieren la inhibición de un enzima cuyo modo de acción preferido es catalizar la hidrólisis de una funcionalidad éster, siendo dicha afección obesidad o un trastorno relacionado con la obesidad.

  32. 288.-

    Método y sistema para consolidar clases de ahorro de potencia

    (10/2012)

    Un método en una estación móvil para consolidar clases de ahorro de potencia, incluyendo: en un entorno de medios mezclados que tiene una pluralidad de conexiones de aplicación asociadas con diferentesclases de ahorro de potencia, identificar una conexión de aplicación primaria; definir una clase de ahorro de potencia consolidada en base a una propiedad de demanda de la conexión deaplicación primaria; y consolidar al menos algunas de las conexiones de aplicación restantes con la clase de ahorro de potenciaconsolidada de tal manera que la clase de ahorro de potencia consolidada esté asociada con múltiples conexionesde aplicación.

<< · 5 · 7 · < · 9 · > · 11 · 13 · 18 · 27 · >>