19 patentes, modelos y diseños de AFFIRIS AG

Vacunas a base de péptidos de la proteína C5a de complemento.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(23/01/2019). Inventor/es: MATTNER, FRANK, STAFFLER,GÜNTHER, LANDLINGER,CHRISTINE. Clasificación: A61K39/00, C07K7/06, C07K7/04.

Vacuna que comprende por lo menos un péptido que consiste en la secuencia de aminoácidos ANISHKDMQLGR (SEC ID nº 3), NISHKDMQLGR (SEC ID nº: 4), SHKDMQLGR (SEC ID nº: 6) o KDMQLGR (SEC ID nº: 7) que se acopla o fusiona a una proteína portadora que comprende por lo menos un epítopo de linfocitos T para la utilización en el tratamiento de un trastorno mediado por complemento, en la que el trastorno mediado por complemento se selecciona de entre el grupo que consiste en enfermedad de Alzheimer, enfermedad de Parkinson, enfermedad de Huntington, degeneración macular relacionada con la edad (AMD), artritis reumatoide (RA), síndrome antifosfolípido, asma, y ateroesclerosis.

PDF original: ES-2718632_T3.pdf

Vacuna peptídica de PCSK9.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(12/12/2018). Inventor/es: BRUNNER,SYLVIA, STAFFLER,GÜNTHER, BILCIKOVA,ERIKA, JUNO,CLAUDIA, LINZMAYER-HIRT,POLA, SCHUH,BIRGIT, GALABOVA,GERGANA, WINSAUER,GABRIELE. Clasificación: A61K39/00, C07K16/40, C12N9/64, A61K47/64.

Vacuna que comprende por lo menos un péptido seleccionado de entre el grupo SIPWSLERIT (SEC ID nº 21), VIPWNLERIL (SEC ID nº 55) y SVPWNLERIQ (SEC ID nº 60), en la que dicho por lo menos un péptido se acopla o fusiona con un portador farmacéuticamente aceptable.

PDF original: ES-2693572_T3.pdf

Procedimiento para diagnosticar la enfermedad de Alzheimer (AD).

Sección de la CIP Física

(30/11/2018). Inventor/es: MATTNER, FRANK, SCHMIDT, WALTER, STAFFLER,GÜNTHER, MAIRHOFER,ANDREAS, SCHNEEBERGER,ACHIM, LUTTEROVA,MARTINA. Clasificación: G01N33/68.

Procedimiento para diagnosticar la enfermedad de Alzheimer (AD) en el que los anticuerpos específicos de Aß en una muestra biológica de una persona que se sospecha presenta AD son detectados comprendiendo las etapas siguientes: - poner en contacto la muestra con agregados de Aß y permitir que los anticuerpos específicos de Aß se unan a los agregados de Aß, y - detectar los anticuerpos específicos de Aß unidos a los agregados de Aß mediante una técnica de detección de partículas individuales, preferentemente mediante la clasificación de células activadas por fluorescencia (FACS); y en el que la cantidad de los anticuerpos específicos de Aß detectada se compara con la cantidad en una muestra de estado de AD conocido.

PDF original: ES-2692185_T3.pdf

Mimotopos de alfa-sinucleína y vacunas de los mismos para el tratamiento de los trastornos neurodegenerativos.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(31/10/2018). Inventor/es: MANDLER,MARKUS, SANTIC,RADMILA, WENINGER,HARALD, KOPINITS,EDITH. Clasificación: A61K39/00, C07K7/06, A61P25/00, A61K38/08.

Utilización de por lo menos un compuesto que comprende una secuencia de aminoácidos seleccionada de entre el grupo que consiste en DQPVLPD, DMPVLPD, DSPVLPD, DQPVLPDN, DMPVLPDN, DSPVLPDN, HDRPVTPD, DRPVTPD, DVPVLPD, DTPVYPD, DTPVIPD, HDRPVTPDN, DRPVTPDN, DVPVLPDN, DTPVYPDN, DQPVLPDG, DMPVLPDG, DSPVLPDG, DHPVHPDS, DMPVSPDR, DRPVYPDI, DHPVTPDR, DTPVLPDS, DMPVTPDT, DAPVTPDT, DSPVVPDN, DLPVTPDR, DSPVHPDT, DAPVRPDS, DMPVWPDG, DRPVQPDR, YDRPVQPDR, DMPVDADN, DQPVLPD y DMPVLPD, en la que dicho compuesto comprende un vehículo farmacéuticamente aceptable acoplado a la secuencia de aminoácidos, presentando dicho compuesto una capacidad de unión a un anticuerpo que es específico para un epítopo de alfa-sinucleína que comprende la secuencia de aminoácidos DMPVDPDN y resultando apto para inducir la formación in vivo de anticuerpos que se unen a la alfa-sinucleína para producir un medicamento para prevenir y/o tratar las sinucleinopatías.

PDF original: ES-2688118_T3.pdf

Vacuna basada en el componente de complemento C5A.

(13/09/2017) Vacuna que comprende por lo menos un péptido que consiste en 7 a 19 residuos aminoácidos que consiste en la secuencia de aminoácidos: (X3)mKDX2QLGX1 (SEC ID nº 99), en la que X1 es un residuo aminoácido seleccionado de entre el grupo que consiste en alanina, asparagina, glutamina, glicina, histidina, isoleucina, leucina, lisina, metionina, serina, treonina, tirosina y valina, X2 es un residuo aminoácido seleccionado de entre el grupo que consiste en alanina, arginina, histidina, isoleucina, leucina, lisina, metionina, treonina, tirosina y valina, X3 es (X4)nANISX5 (SEC ID nº 100) o un fragmento truncado en el extremo N-terminal del mismo que consiste en 1 a 4 residuos aminoácidos, X4 es VVASQLR (SEC ID nº 101) o un fragmento truncado en el extremo N-terminal del mismo que consiste en 1 a 6 residuos aminoácidos,…

Sustancias y procedimientos para la utilización en la prevención y/o el tratamiento en la enfermedad de Huntington.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia Física

(17/05/2017). Inventor/es: SMRZKA,OSKAR, BARTL,STEFAN. Clasificación: A61K39/00, C07K16/18, G01N33/68, A61M1/36, A61M1/34.

Dispositivo de aféresis que comprende un portador sólido que puede ponerse en contacto con el flujo sanguíneo o de plasma, en el que el portador sólido incluye una molécula de unión a la huntingtina (HTT).

PDF original: ES-2660372_T3.pdf

Tratamiento y prevención de la enfermedad de Alzheimer (AD).

Sección de la CIP Necesidades corrientes de la vida

(08/03/2017). Inventor/es: MATTNER, FRANK, SCHMIDT, WALTER, VON BONIN,Arne, MANDLER,MARKUS, SCHNEEBERGER,ACHIM. Clasificación: A61K33/06, A61P25/28.

Oxihidróxido de aluminio para su utilización en el tratamiento y la prevención de la enfermedad de Alzheimer (AD), en el que el oxihidróxido de aluminio está contenido en una preparación farmacéutica, y en el que dicha preparación contiene oxihidróxido de aluminio como el único ingrediente eficaz.

PDF original: ES-2651537_T3.pdf

Vacuna de PCSK9.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(21/12/2016). Inventor/es: BRUNNER,SYLVIA, STAFFLER,GÜNTHER, JUNO,CLAUDIA, GALABOVA,GERGANA, WANKO,BETTINA, WINDWARDER,MARKUS, WINSAUER,GABRIELE. Clasificación: A61K39/00, A61P9/00, A61P3/06, C12N9/64.

Vacuna que comprende por lo menos dos fragmentos de proproteína convertasa subtilisina/kexina de tipo 9 (PCSK9), en la que un primer fragmento de dichos por lo menos dos fragmentos comprende por lo menos 9 residuos aminoácidos consecutivos de los residuos aminoácidos 153 a 165 de PCSK9 según la SEC ID nº 9 y un segundo fragmento de dichos por lo menos dos fragmentos comprende por lo menos 9 residuos aminoácidos consecutivos de los residuos aminoácidos 209 a 222 de PCSK9 según la SEC ID nº 9.

PDF original: ES-2618796_T3.pdf

Utilización de mimotopos de epítopos de alfa-sinucleína para el tratamiento de enfermedades de cuerpos de Lewy.

(02/03/2016) Composición que comprende por lo menos un péptido o polipéptido que comprende la secuencia de aminoácidos siguiente: (X1)nX2X3X4X5GX6P(X7)m (Fórmula I), en la que: X1 es cualquier residuo aminoácido, X2 es un residuo aminoácido seleccionado de entre el grupo que consiste en lisina (K), arginina (R), alanina (A) e histidina (H), X3 es un residuo aminoácido seleccionado de entre el grupo que consiste en asparagina (N), glutamina (Q), serina (S), glicina (G) y alanina (A), preferentemente asparagina (N), serina (S), glicina (G) y alanina (A), X4 es un residuo aminoácido seleccionado de entre el grupo que consiste en ácido glutámico (E), ácido aspártico (D) y alanina (A), X5 es un residuo aminoácido seleccionado de entre el grupo que…

Vacuna de PCSK9.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(27/01/2016). Inventor/es: BRUNNER,SYLVIA, STAFFLER,GÜNTHER, JUNO,CLAUDIA, GALABOVA,GERGANA, WANKO,BETTINA, WINDWARDER,MARKUS, WINSAUER,GABRIELE. Clasificación: A61K39/00, A61K39/39, A61P9/00, A61P3/06, C07K16/40, A61K39/385, C12N9/64.

Vacuna que comprende por lo menos dos fragmentos de proproteína convertasa subtilisina/kexina de tipo 9 (PCSK9), en la que por lo menos un fragmento de dichos por lo menos dos fragmentos comprende por lo menos 8 residuos aminoácidos consecutivos de los residuos aminoácidos 150 a 170 de PCSK9 según el SEC ID nº 9 y en la que por lo menos un fragmento de dichos por lo menos dos fragmentos comprende por lo menos 8 residuos aminoácidos consecutivos 205 a 225 de PCSK9 según el SEC ID nº 9.

PDF original: ES-2565757_T3.pdf

Mimotopos de alfa-sinucleína y vacunas de los mismos para el tratamiento de los trastornos neurodegenerativos.

(12/11/2015) Por lo menos un compuesto que comprende un péptido que presenta la secuencia de aminoácidos seleccionada de entre el grupo que consiste en CDQPVLPD, CDMPVLPD, CDSPVLPD, CDQPVLPDN, CDMPVLPDN, CDSPVLPDN, CHDRPVTPD, CDRPVTPD, CDVPVLPD, CDTPVYPD, CDTPVIPD, CHDRPVTPDN, CDRPVTPDN, CDVPVLPDN, CDTPVYPDN, CDQPVLPDG, CDMPVLPDG, CDSPVLPDG, CDHPVHPDS, CDMPVSPDR, CDRPVYPDI, CDHPVTPDR, CDTPVLPDS, CDMPVTPDT, CDAPVTPDT, CDSPVVPDN, CDLPVTPDR, CDSPVHPDT, CDAPVRPDS, CDMPVWPDG, CDRPVQPDR, CYDRPVQPDR, CDMPVDADN, DQPVLPDC y DMPVLPDC, para la utilización para la prevención y/o el tratamiento de las sinucleinopatías.

Fragmentos de PTEC.

(22/07/2015) Péptido que consiste en 6 a 20 residuos aminoácidos y que deriva de la secuencia de aminoácidos VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEC ID nº 23), en el que dicho péptido comprende la secuencia de aminoácidos WWLGID (SEC ID nº 24).

Vacuna.

(22/04/2015) Vacuna para la utilización en el tratamiento y/o la prevención de un trastorno físico asociado al sistema de la angiotensina activado por la renina, que comprende un péptido unido a un portador farmacéuticamente aceptable, caracterizada por que el péptido se selecciona de entre el grupo que consiste en DRAYAHPF, DPGYIHPF y PGYIHPF, y en la que el portador se une al péptido mediante por lo menos un residuo de cisteína unido al extremo N del péptido.

Procedimiento para detectar anticuerpos Aß-específicos en una muestra biológica.

(09/07/2014) Procedimiento para detectar anticuerpos Aß-específicos en una muestra biológica, que comprende las etapas siguientes: - poner en contacto la muestra con agregados Aß o con perlas con agregados Aβ inmovilizados en su superficie, y permitir que los anticuerpos Aß específicos se unan a los agregados Aß, y - detectar los anticuerpos Aβ-específicos que están unidos a los agregados Aβ, mediante una técnica de detección de partículas individuales, preferentemente mediante la clasificación de células activadas por fluorescencia (FACS).

Péptidos para tratar las beta-amiloidosis.

(26/03/2014) Utilización de por lo menos un compuesto que comprende una secuencia de aminoácidos seleccionada de entre el grupo que consiste en SEFKHG(C), TLHEFRH(C), ILFRHG(C), TSVFRH(C), SQFRHY(C), LMFRHN(C), SPNQFRH(C), ELFKHHL(C), THTDFRH(C), DEHPFRH(C), QSEFKHW(C), ADHDFRH(C), YEFRHAQ(C) y TEFRHKA(C) para producir un medicamento destinado a la prevención y/o al tratamiento de la b-amiloidosis

Tratamiento de la aterosclerosis.

(16/10/2013) Compuesto que comprende la secuencia aminoácida FGFPAHVFIDWLQSLS o FGFPAHVYIDWLQSLS oFGFPAHVFIDWLQSLN para su utilización en la prevención y/o el tratamiento de la aterosclerosis, enfermedadoclusiva arterial periférica, enfermedad cardiaca coronaria o lesión cerebral apopléjica.

Terapia combinada para la prevención o tratamiento de la enfermedad de Alzheimer y kit correspondiente.

(23/07/2013) Kit destinado a ser utilizado para la prevención o tratamiento de la enfermedad de Alzheimer (EA), que comprende - un agente para la inducción de una secuestración de β-amiloide (Aβ) en el plasma, estando seleccionado elagente para la inducción de una secuestración de Aβ en el plasma de entre el grupo constituido por gelsolina,GM1, anticuerpos específicos para Aβ o una vacuna activa o pasiva específica para Aβ y - un dispositivo de aféresis, que comprende un soporte sólido que puede entrar en contacto con el flujo sanguíneoo de plasma, que presenta un receptor de unión a una proteína precursora de ß-amiloide (APP), siendo elreceptor de unión a APP seleccionado de entre el grupo constituido por anticuerpos anti-APP, anticuerpos…

Compuestos peptídicos para tratar amiloidosis.

(05/09/2012) Utilización de por lo menos un compuesto que comprende la secuencia de aminoácidos (X1) mHX2X3X4X5FX6 (X7) n (Fórmula II), en la que X1 es serina (S), treonina (T) o cisteína (C), X2 es la glutamina (Q), treonina (T) o metionina (M), X3 es lisina (K) o arginina (R), X4 es la leucina (L), metionina (M), X5es triptófano (W), tirosina (Y), fenilalanina (F) o isoleucina (I), X6 es asparagina (N), ácido glutámico (E), alanina (A) o cisteína (C), X7 es cisteína (C), n y m son, independientemente, 0 ó 1, presentando dicho compuesto una capacidad de unión a un anticuerpo que es específico para un epítopo del péptido beta amiloide (Aß) que comprende la secuencia de aminoácidos HQKLVF y/o HQKLVFFAED para producir un medicamento destinado a la prevención y/o al tratamiento de la º-amiloidosis que incluye la…

PROCEDIMIENTOs PARA PREVENIR Y TRATAR LA ENFERMEDAD DE ALZEHIMER (AD).

(20/05/2010) Utilización de un compuesto, constituido por - un péptido de 5 a 15 aminoácidos que incluye una secuencia aminoácida, seleccionada de entre el grupo constituido por DKELRI, DWELRI, YAEFRG, EAEFRG, DYEFRG, DRELRI, GREFRN, EYEFRG, DWEFRDA, SWEFRT y DKELR, conteniendo dicho péptido un residuo adicional de cisteína en el extremo C y - un soporte proteico acoplado mediante dicho residuo de cisteína a dicho péptido, para la preparación de una vacuna destinada a la enfermedad de Alzheimer (AD)

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015