GLP-2 para su uso en el tratamiento de la atrofia muscular.

Composición que comprende un péptido similar al glucagón 2 (GLP-2) para uso en el tratamiento,

limitación y/o prevención de la atrofia del músculo esquelético.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2010/065021.

Solicitante: NESTEC S.A..

Nacionalidad solicitante: Suiza.



Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/26 A […] › A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00). › Glucagón.
  • A61P1/00 A61 […] › A61P ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS O DE PREPARACIONES MEDICINALES.Medicamentos para el tratamiento de trastornos del tracto alimentario o del aparato digestivo.

PDF original: ES-2539917_T3.pdf


Fragmento de la descripción:

GLP-2 para su uso en el tratamiento de la atrofia muscular

La presente invención se refiere en general al campo de la nutrición y la salud. En particular, la presente Invención proporciona una composición que permite tratar, limitar o prevenir la atrofia muscular. Las realizaciones de la presente invención se refieren a composiciones que contienen GLP-2 y también composiciones que estimulan la secreción de GLP-2 en un cuerpo para tratar o prevenir la atrofia muscular.

La pérdida de masa muscular en estados catabólicos es una causa indirecta de la morbilidad y la mortalidad debido a que la capacidad del organismo para recuperarse de tales eventos catabólicos está fuertemente afectada.

Por lo tanto, un reto importante en la nutrición clínica es mejorar el equilibrio de proteínas de todo un cuerpo, y por lo tanto el equilibrio de proteínas en el músculo esquelético, que es el principal reservorio de proteínas de un cuerpo. Sin embargo, las moléculas de anabólicas tales como la insulina, los aminoácidos de cadena ramificada, o la glutamina tienen menor efecto positivo, si es que existe sobre los músculos en pacientes caquécticos.

Se ha demostrado recientemente en ratas jóvenes con inanición / realimentadas que la proteólisis dependiente del proteosoma de la ubiquitina del músculo esquelético es poco sensible a los aumentos tanto en los niveles de insulina plasmática como de aminoácidos. Esta conclusión se basa en las mediciones in vitro de la proteólisis muscular ± inhibidores proteolíticos (incluyendo el inhibidor del proteosoma MG132), sobre la expresión génica de varios componentes de la vía proteosoma-ubiquitina, y sobre las tasas de ubiquitinación en el músculo esquelético (Kee, AJ, et al., 23, Journal of Physiology 546: 765-776).

Si se produce una disminución en la masa de un músculo, entonces esta condición se denomina comúnmente "atrofia muscular". La atrofia muscular se caracteriza por una pérdida parcial de la masa muscular. Esta atrofia muscular está relacionada con una disminución la síntesis de proteínas o con un aumento de la degradación de proteínas o con ambos. La consecuencia de la atrofia muscular es generalmente un deterioro de la calidad de vida. Las tareas diarias se vuelven más y más difíciles de realizar y las debilidades repentinas pueden causar accidentes. Los sujetos que sufren de atrofia muscular son a menudo sujetos de edad avanzada y / o sujetos que sufren de trastornos en la contracción de la masa muscular como consecuencia.

La estimulación eléctrica funcional o simplemente el ejercicio son medidas típicas para trabajar contra la atrofia muscular. Sin embargo, dependiendo de la condición general del sujeto a tratar, estos métodos pueden no ser siempre aplicables.

Sería por tanto deseable disponer de una composición que permita tratar o prevenir la atrofia muscular y que también se puede utilizar en sujetos que no son capaces de aumentar su actividad física.

En consecuencia, era el objeto de la presente invención mejorar el estado de la técnica y proporcionar una composición ingerible para tratar o prevenir la atrofia muscular.

Los inventores lograron este objetivo proporcionando la materia objeto de las reivindicaciones independientes. Las reivindicaciones dependientes desarrollan adicionalmente la presente invención.

Los inventores han realizado un experimento in vivo para estudiar el efecto de la administración GLP-2 sobre el metabolismo de las proteínas en ratas jóvenes en un modelo inanición / realimentación.

Se encontró que la atrofia del intestino delgado inducida por inanición en ratas jóvenes está asociada con un aumento de las actividades de la catepsina y del proteosoma. Un aumento inducido por GLP-2 en masa del intestino delgado se asoció con una reducción de la actividad de la catepsina tanto en el yeyuno y como el íleon, mientras que la actividad de peptidasa del proteosoma no se modificó. El tratamiento GLP-2 de las ratas hambrientas (i) redujo la atrofia intestino delgado, (ii) previno el aumento de la actividad de algunas catepsinas, y (iii) limitó la disminución en altura de las vellosidades y profundidad de la cripta del yeyuno.

Por último, la administración de GLP-2 aceleró la recuperación tanto de intestino delgado y masas musculares esqueléticas cuando las ratas en ayunas se realimentaron durante 6 horas o 24 horas.

En el presente trabajo la atrofia del intestino delgado inducida por inanición se redujo en un 16% cuando las ratas recibieron GLP-2. El intestino delgado se recuperó totalmente después de 24 horas de realimentación en ratas tratadas con GLP-2, mientras que el 26% de la atrofia aún prevaleció en los animales no tratados.

Es importante destacar, la recuperación de la masa muscular esquelética en paralelo a la pequeña recuperación intestinal, que se aceleró en las ratas tratadas con GLP-2. Los músculos esqueléticos son propensos a no llevar receptores GLP-2. Por lo tanto, en conjunto estas observaciones demuestran que la manipulación de la masa del intestino delgado tiene un impacto beneficioso sobre la masa muscular esquelética.

Para el mejor conocimiento de los inventores, este es el primer estudio que demuestra que la manipulación de la masa del intestino delgado tiene un impacto beneficioso sobre la masa del músculo esquelético, por ejemplo, durante los períodos de recuperación siguientes condiciones catabólicas como el ayuno.

Estos hallazgos pueden ser aplicados en todas las condiciones en que se desee acelerar el intestino delgado y / o la recuperación del músculo esquelético, por ejemplo, en situaciones clínicas.

El presente trabajo muestra también que hay una priorización en el efecto anabólico de la nutrición: la recuperación del intestino siempre precede a la recuperación de la masa muscular.

En consecuencia, la presente invención se refiere a una composición que ayuda a la recuperación del intestino para tratar o prevenir la atrofia muscular.

También se refiere a la utilización de una composición que ayuda a la recuperación del intestino mediante la preparación de una composición para tratar o prevenir la atrofia muscular.

Las composiciones que ayudan a la recuperación del intestino son conocidas por el especialista en la materia.

Por ejemplo, una composición que ayuda a la recuperación de la masa intestinal puede ser una composición que comprende factores tróficos intestinales. Factores tróficos intestinales son conocidos por los expertos en la técnica y comprenden por ejemplo las hormonas de crecimiento (GH), y / o el péptido intestinal vasoactivo (VIP).

Además, una composición que ayuda a la recuperación de la masa intestinal puede ser una composición que comprende el péptido similar al glucagón 2 (GLP-2) y / o una composición que estimula la secreción de GLP-2 en un cuerpo.

En consecuencia, la presente invención se refiere a una composición que comprende péptido similar al glucagón 2 (GLP-2) para tratar o prevenir la atrofia muscular.

Un péptido similar al glucagón 2 (GLP-2) es un péptido de 33 amino ácidos derivado del tejido específico, resultado del procesamiento post-traduccional del gen de proglucagón se expresado en las células intestinales L


Drucker et al., Gut, 22, 5, 428-435 y Burrin et al., Diario de Nutrición, 21, páginas 79-712, reportaron que hay una homología relativamente alta (87-97%) en la secuencia del péptido GLP-2 entre las especies, incluidos los seres humanos, cerdos, vacas y ratas. Por lo tanto, el GLP-2 de la presente invención incluye GLP-2 humano y proteínas con al menos 87% de homología con la secuencia de GLP-2 humano, preferiblemente al menos 9% de homología de secuencia del GLP-2 humano, por ejemplo de al menos 95% homología con la secuencia del GLP-2 humano.

El GLP-2 humano tiene la siguiente secuencia:


Por ejemplo, la A en la posición 2 puede ser reemplazada por una G para evitar la degradación de GLP-2 por la dipeptidil peptidasa IV (DP IV) y por lo tanto para aumentar su vida media. El GLP-2 resultante tiene la siguiente secuencia:


Además las proteínas de GLP-2 que pueden utilizarse por ejemplo de acuerdo con la presente invención son las siguientes:


Mientras que GLP-2 puede ser ingerida para lograr el objeto de la presente invención, la presente invención también se refiere a composiciones que cuando se ingieren estimulan la secreción de GLP para tratar o prevenir la atrofia... [Seguir leyendo]



1. Composición que comprende un péptido similar al glucagón 2 (GLP-2) para uso en el tratamiento, limitación y/o prevención de la atrofia del músculo esquelético.

2. Composición que comprende GLP-2 para su uso de acuerdo con de la reivindicación 1, mediante el apoyo a la recuperación del intestino.

3. Composición que comprende GLP-2 para su uso de acuerdo con una de la reivindicaciones precedentes, donde la composición además comprende factores tróficos intestinales, tales como hormonas de crecimiento (GH), y/o péptidos vasoactivos intestinales.

4. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones 1- 3, donde GLP-2


HGDGSFSDEMNTILDNLATRDFINWLIQTKITD (SEQ-ID No. 4), o combinaciones de las mismos.

5. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes para el mejoramiento de la recuperación del músculo esquelético.

6. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes para el mejoramiento de la masa del músculo esquelético durante periodos de recuperación seguidos de condiciones catabólicas.

7. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes para ser administrada durante o después de un período de desnutrición.

8. Composición que comprende GLP-2 para su uso de acuerdo con la reivindicación 7 donde el período de malnutrición es causado por una infección, cáncer, SIDA, daños por quemaduras, traumas, o por una ingesta insuficiente de alimentos, o a partir del consumo de una dieta que no suministra los todos los nutrientes en cantidades suficientes.

9. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes, donde la composición se selecciona del grupo que consiste en un producto alimenticio, un nutracéutico, una bebida, un aditivo alimentario y un medicamento.

1. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes, donde la composición es una fórmula nutricional.

11. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes, en el que la composición está destinada para la administración oral, enteral y/o parenteral.

12. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes, en donde la composición comprende una fuente de hidratos de carbono en una cantidad de 7-19 g / 1 kcal de la composición.

13. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes, en donde la composición comprende una fuente de lípidos en una cantidad de 1,5-5, g /1 kcal de la composición.

14. Composición que comprende GLP-2 para su uso de acuerdo con una de las reivindicaciones precedentes, en donde la composición comprende una fuente de proteína en una cantidad de 2, -8,5 g /1 kcal de la composición.


Patentes similares o relacionadas:

Imagen de 'Hidrolizado de caseína para uso en el tratamiento de enfermedades…'Hidrolizado de caseína para uso en el tratamiento de enfermedades inflamatorias, del 29 de Julio de 2020, de MJN U.S. Holdings, LLC: Una composición nutricional, que comprende un lípido o una fase grasa, una fuente de proteína y un hidrolizado de caseína para uso en el tratamiento […]

Aditivo para piensos, alimentos, agua potable o preparaciones farmacéuticas, del 20 de Julio de 2020, de ERBER AKTIENGESELLSCHAFT: Aditivo para piensos, alimentos, agua potable o preparaciones farmacéuticas, preparado a partir de al menos una especie de cornejo, en particular Cornus mas, Cornus officinalis, […]

Complemento alimenticio que comprende ácidos resínicos, del 15 de Julio de 2020, de HANKKIJA OY: Utilización no terapéutica de un complemento alimenticio que comprende una composición basada en ácido resínico que comprende más del 10 % (p/p) de ácidos […]

Cepa de Faecaslibacterium Prausnitzii CNCM I-4573 para el tratamiento y la prevención de una inflamación gastrointestinal, del 15 de Julio de 2020, de Institut national de recherche pour l'agriculture, l'alimentation et l'environnement: Cepa bacteriana de la especie Faecalibacterium prausnitzii depositada en la CNCM bajo el número de acceso CNCM I-4573, para su utilización en el tratamiento y/o la prevención […]

Antagonistas del receptor p2x7 derivados de N-[2-(4-fenoxipiperidin-1-il)-2-(1,3-tiazol-5-il)etil]benzamida y N-[2-(4-benciloxipiperidin-1-il)-2-(1,3-tiazol-5-il)etil]benzamida sustituidas, del 15 de Julio de 2020, de AXXAM S.P.A: Un compuesto de la siguiente fórmula (I) o una sal farmacéuticamente aceptable del mismo: **(Ver fórmula)** incluyendo cualquier forma estereoquímicamente […]

Derivado de amina cíclica y uso farmacéutico del mismo, del 1 de Julio de 2020, de TORAY INDUSTRIES, INC.: Un derivado de amina cíclica representado por la siguiente fórmula general (I): **(Ver fórmula)** donde R1 representa un grupo alquiloxi que tiene de 1 a 3 átomos […]

Compuestos utilizados como inhibidores de la quinasa reordenada durante la transfección (RET), del 1 de Julio de 2020, de GlaxoSmithKline Intellectual Property Development Limited: Un compuesto de acuerdo con la Fórmula (I), o una sal farmacéuticamente aceptable del mismo: **(Ver fórmula)** en donde: X es N o CR5; Y es un enlace; […]

Usos de composiciones de caseína, del 17 de Junio de 2020, de FONTERRA CO-OPERATIVE GROUP LIMITED: Uso de una composicion de caseina para aumentar la concentracion de leucina libre en suero sanguineo en un sujeto, en donde la composicion de caseina comprende o la caseina […]

Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .