Biomarcadores asociados a la nefropatía.

Un método de diagnóstico de la nefropatía en un sujeto, que comprende:



obtener una muestra de orina de un sujeto que se sospecha que tiene nefropatía,

determinar en la muestra de orina un nivel de un biomarcador o de una combinación de biomarcadores seleccionado del grupo que consiste en:

(i) receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos, y

(ii) una combinación del receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos y de la alfa- 1-glicoproteína ácida o uno de sus fragmentos,

en donde el fragmento de receptor-2 similar a Ig asociado a leucocitos es

DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) y el fragmento de alfa-1-glicoproteína ácida es GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2); y

evaluar si el sujeto tiene nefropatía basándose en el nivel del biomarcador o de la combinación de biomarcadores,

en donde un aumento en el nivel del biomarcador o de la combinación de biomarcadores, en comparación con un punto de referencia que representa el nivel del mismo biomarcador o de la combinación de biomarcadores en un sujeto sin nefropatía, indica que el sujeto tiene nefropatía, en donde el punto de referencia es el punto medio entre el nivel medio del biomarcador o de la combinación de biomarcadores en un grupo de pacientes con nefropatía y el de un grupo de sujetos sin nefropatía.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/CA2010/000096.

Solicitante: INDUSTRIAL TECHNOLOGY RESEARCH INSTITUTE.

Nacionalidad solicitante: Taiwan, Provincia de China.

Dirección: No. 195, Sec. 4, Chung Hsing Road Chutung, Hsinchu 31040 TAIWAN.

Inventor/es: TSENG,TZU-LING, LU,CHING-FANG, LIN,WEI-YA, HSU,TSAI-WEI, YEH,MARY YA-PING, CHEN,YI-TING, YANG,CHWEI-SHIUN.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • C07K14/705 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › Receptores; Antígenos celulares de superficie; Determinantes celulares de superficie.
  • C07K16/28 C07K […] › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra receptores, antígenos celulares de superficie o determinantes celulares de superficie.
  • C40B30/00 C […] › C40 TECNOLOGIA COMBINATORIA.C40B QUIMICA COMBINATORIA; BIBLIOTECAS, p. ej. QUIMIOTECAS, BIBLIOTECAS IN SILICO. › Procedimientos de selección de bibliotecas.
  • G01N27/00 SECCION G — FISICA.G01 METROLOGIA; ENSAYOS.G01N INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION DE SUS PROPIEDADES QUIMICAS O FISICAS (procedimientos de medida, de investigación o de análisis diferentes de los ensayos inmunológicos, en los que intervienen enzimas o microorganismos C12M, C12Q). › Investigación o análisis de materiales mediante el empleo de medios eléctricos, electroquímicos o magnéticos (G01N 3/00 - G01N 25/00 tienen prioridad; medida o ensayo de variables eléctricas o magnéticas o de las propiedades eléctricas o magnéticas de los materiales G01R).
  • G01N33/493 G01N […] › G01N 33/00 Investigación o análisis de materiales por métodos específicos no cubiertos por los grupos G01N 1/00 - G01N 31/00. › de orina.
  • G01N33/53 G01N 33/00 […] › Ensayos inmunológicos; Ensayos en los que interviene la formación de uniones bioespecíficas; Materiales a este efecto.
  • G01N33/543 G01N 33/00 […] › con un soporte insoluble para la inmovilización de compuestos inmunoquímicos.
  • G01N33/566 G01N 33/00 […] › utilizando un soporte específico o proteínas receptoras como reactivos para la formación de uniones por ligando.
  • G01N33/68 G01N 33/00 […] › en los que intervienen proteínas, péptidos o aminoácidos.

PDF original: ES-2530574_T3.pdf

 


Fragmento de la descripción:

Biomarcadores asociados a la nefropatía Antecedentes de la invención

La nefropatía, conocida comúnmente como daño del riñón, es causada, entre otras, por la diabetes, la presión arterial alta, la toxicidad de los fármacos y la inflamación.

Típicamente, la nefropatía se diagnostica determinando el nivel de proteinuria (por ejemplo, el nivel de albúmina en la orina) o examinando la tasa de filtración glomerular (TFG), un indicador de la función renal. Ambos procedimientos no son adecuados para detectar la nefropatía en fase Inicial, que normalmente no presenta síntomas. Aunque la nefropatía también puede ser detectada por blopsla renal, este procedimiento Invasivo no es un procedimiento de diagnóstico Ideal.

Es de gran Importancia desarrollar un método para detectar la nefropatía en fase Inicial. La clave para lograr este objetivo es la identificación de biomarcadores fiables asociados a la nefropatía incipiente.

A continuación se resume la técnica anterior pertinente relacionada con la presente invención.

El documento de patente WO 27/124419 A1 describe un método y un kit para la detección precoz del estado renal deteriorado. Dicho documento describe, en una muestra proporcionada, la detección de la presencia de una proteína seleccionada del grupo que consiste en aprotinina, alfa-1-microglobulina (A1M), alfa-1-gllcoproteína áclda (A1AG), microalbúmina y sus combinaciones, siendo su presencia un biomarcador temprano de un cambio en el estado renal.

El documento de patente WO 28/141285 A2 describe reactivos y métodos para el diagnóstico de una enfermedad renal en un ser humano o animal. Los métodos de dicho documento comprenden la etapa de analizar una muestra de orina de un ser humano o animal diabético con un reactivo inmunológico inmunológlcamente específico para una proteína o péptido producido diferencialmente en la orina de un paciente diabético que tenga o esté en riesgo de desarrollar una enfermedad renal. Además, el reactivo inmunológico inmunológlcamente específico para al menos una de sus proteínas o péptidos de la orina es zinc-alfa-2-glicoproteína, alfa-1-mlcroglobullna, alfa-1-gllcoproteína ácida 1, alfa-1-glicoproteína ácida 1, etc.

La referencia bibliográfica H. Jlang et al. (NEPHROLOGY 29; 14, 332-337) describe una nueva proteína relacionada con la nefropatía diabética, orosomucolde (alfa-1-gllcoproteína ácida), identificada por un método proteómico. Dicha referencia enseña también que el aumento de la excreción urinaria de orosomucoide es un predictor de riesgo de la nefropatía diabética.

El documento de patente WO 28/21431 A2 describe métodos y materiales Implicados en el diagnóstico y seguimiento del estado de rechazo de un trasplante y el trastorno Inmunológico usando variantes por empalme para mejorar la evaluación de la actividad ¡nmunológlca o Inflamatoria en muestras de sujetos.

La referencia bibliográfica S.A. Varghese et al. (J. Am. Soc. Nephrol. 18: 913-922, 27) describe biomarcadores en la orina que predicen la causa de la enfermedad glomerular. Dicha referencia describe también que veintiún manchas en gel de las proteínas procedentes de los pacientes son más Importantes para la diferenciación de las enfermedades y que las manchas se Identifican por espectrometría de masas como formas con carga de 11 proteínas plasmáticas: orosomucoide, transferrlna, a-1-mlcroglobullna, zlnc-a-2-gllcoproteína, a-1-antitripsina, factor B del complemento, haptoglobina, transtlretlna, proteína de unión al retlnol plasmático, albúmina y hemopexina.

La referencia bibliográfica M. Sharma et al. (Proteomics Clin. Appl. 28 june 18; 2 (7-8): 165-186) describe biomarcadores proteicos en la orina de lesiones por radiación. Dicha referencia enseña que se ha encontrado que después de la irradiación aumentan la peptidasa relacionada con la callcreína tlsular 1, la clstatina C inhibidora de la cisteína-proteinasa y la histidina oxidada mientras que disminuye un número de Inhibidores de proteinasas incluyendo la proteína de unión a la calicreína y la albúmina.

La referencia bibliográfica S. Jain et al. (JAPI VOL. 53 JUNE 25 (25-6), pp 513-52) describe marcadores de proteínas en la orina para la predicción precisa del trastorno renal diabético. El análisis por electroforesis bidimensional en gel (2-DGE) de las muestras de orina de pacientes diabéticos de tipo II revela cuatro proteínas principales junto con la albúmina en estas muestras, que son zinc-alfa-2-glicoproteína, alfa-1-glicoproteína ácida, alfa-1-microglobulina e IgG.

La referencia bibliográfica R. J. Lebbink et al. (The Journal of Immunology, 28, 18: 1662-1669) describe un nuevo mecanismo de regulación inmunológica por un receptor similar a Ig asociado a leucocitos soluble que regula el potencial inhibidor del receptor-1 similar a Ig asociado a leucocitos unido a la membrana por medio de la competencia por los ligandos.

El documento de patente US 24/991 A1 describe métodos y materiales implicados en el diagnóstico de afecciones artríticas que están acompañadas por una deficiencia de NADPH-oxidasa, métodos y materiales

implicados en el tratamiento, prevención o retraso de la aparición de afecciones artríticas que están acompañadas por una deficiencia de NADPH-oxidasa y métodos y materiales implicados en la identificación de agonistas y antagonistas de la actividad de NADPH-oxidasa.

La referencia bibliográfica S. G. Coca et al. (Kidney International (28) 73, 18-116) describe biomarcadores para el diagnóstico y la estratificación del riesgo de lesiones renales agudas. Dicha referencia también describe que la cistatina C sérica y la lipocalina asociada a la gelatinasa de los neutrófllos en la orina, IL-18, etc., se comportaron mejor en el diagnóstico precoz de lesiones renales agudas.

La referencia bibliográfica W. Ouyang (Journal of Immunological Methods 292 (24) 19-117) se refiere al establecimiento de un sistema ELISA para determinar los niveles del receptor-1 similar a Ig asociado a leucocitos soluble en suero de pacientes con fiebre hemorrágica con síndrome renal y trasplante de riñón. Dicha referencia demuestra que el receptor-1 similar a Ig asociado a leucocitos puede ser liberado cuando se activan los linfocitos.

Sumario de la invención

La presente invención se basa en los descubrimientos inesperados de que los niveles en orina tanto de receptor-2 similar a Ig asociado a leucocitos como de alfa-1-glicoproteína-2 acida, y fragmentos de estas dos proteínas con SEQ ID NO: 1 y SEQ ID NO: 2 respectivamente, son significativamente superiores en un paciente con nefropatía que en un paciente sin nefropatía. Estas moléculas de proteínas son, por lo tanto, biomarcadores fiables para el diagnóstico de la nefropatía en fase inicial.

Por consiguiente, un aspecto de esta Invención se refiere a un método de diagnóstico de la nefropatía. Este método incluye al menos las siguientes etapas: (a) obtener una muestra de orina de un sujeto que se sospecha que tiene nefropatía, (b) determinar en la muestra de orina un nivel de un biomarcador y (c) evaluar si el sujeto tiene nefropatía basándose en el nivel del biomarcador. El biomarcador utilizado en el método que se acaba de describir es uno de los siguientes: (i) receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos que es DFLELLVKGTVPGTEASGFDAP (SEQ ID NO: 1), (ii) una combinación del antes mencionado con alfa-1-glicoproteína ácida o uno de sus fragmentos que es GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2).

Un aumento en el nivel del biomarcador o de la combinación de biomarcadores anteriores, en comparación con el de un sujeto sin nefropatía, Indica que el sujeto tiene nefropatía. En un ejemplo, el nivel de biomarcador se determina por un ensayo de espectrometría de masas (por ejemplo, espectrometría de masas en la que la ionización se efectúa mediante desorción por láser asistida por matriz (MALDI-MS), cromatografía de líquidos-espectrometría de masas (LC-MS) y cromatografía de líquidos-doble espectrometría de masas (LC-MS/MS)). En otro ejemplo, se determina por un ensayo inmunológico (por ejemplo, ensayo de ¡nmunoabsorclón ligado a enzimas (ELISA), transferencia de Western, radioinmunoensayo (RIA), inmunoensayo fluorescente (FIA) e inmunoensayo luminiscente (LIA)).

El método de diagnóstico de la nefropatía anteriormente descrito es aplicable tanto a seres humanos como a animales de laboratorio, por ejemplo, los exentos de protelnurla. El término "un animal de laboratorio" utilizado en la presente memoria se refiere a un animal vertebrado utilizado comúnmente en ensayos con animales, por ejemplo, ratón, rata, conejo, gato, perro, cerdo y primate no humano.

Otro... [Seguir leyendo]

 


Reivindicaciones:

1. Un método de diagnóstico de la nefropatía en un sujeto, que comprende:

obtener una muestra de orina de un sujeto que se sospecha que tiene nefropatía,

determinar en la muestra de orina un nivel de un biomarcador o de una combinación de biomarcadores seleccionado del grupo que consiste en:

(i) receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos, y

(¡i) una combinación del receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos y de la alfa- 1-gllcoproteína áclda o uno de sus fragmentos,

en donde el fragmento de receptor-2 similar a Ig asociado a leucocitos es DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) y el fragmento de alfa-1-glicoproteína ácida es GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2); y

evaluar si el sujeto tiene nefropatía basándose en el nivel del biomarcador o de la combinación de biomarcadores,

en donde un aumento en el nivel del biomarcador o de la combinación de biomarcadores, en comparación con un punto de referencia que representa el nivel del mismo biomarcador o de la combinación de biomarcadores en un sujeto sin nefropatía, indica que el sujeto tiene nefropatía, en donde el punto de referencia es el punto medio entre el nivel medio del biomarcador o de la combinación de biomarcadores en un grupo de pacientes con nefropatía y el de un grupo de sujetos sin nefropatía.

2. El método de la reivindicación 1, en donde el nivel del biomarcador o de la combinación de biomarcadores se determina por un ensayo de espectrometría de masas o un ensayo inmunológico.

3. El método de la reivindicación 2, en donde el ensayo de espectrometría de masas se selecciona del grupo que consiste en espectrometría de masas en la que la ionización se efectúa mediante desorción por láser asistida por matriz (MALDI-MS), cromatografía de líquidos-espectrometría de masas (LC-MS) y cromatografía de líquidos-doble espectrometría de masas (LC-MS/MS).

4. El método de la reivindicación 2, en donde el ensayo inmunológico se selecciona del grupo que consiste en ensayo de inmunoabsorción ligado a enzimas (ELISA), transferencia de Western, radioinmunoensayo (RIA), ¡nmunoensayo fluorescente (FIA) e inmunoensayo luminiscente (LIA).

5. El método de la reivindicación 1, en donde el sujeto es un ser humano.

6. El método de la reivindicación 1, en donde el sujeto es un animal de laboratorio.

7. El método de la reivindicación 1, en donde el biomarcadores el receptor-2 similar a Ig asociado a leucocitos.

8. El método de la reivindicación 1, en donde el biomarcador es el fragmento del receptor-2 similar a Ig asociado a

leucocitos.

9. El método de la reivindicación 7 u 8, en donde el sujeto no tiene proteinuria.

1. El método de la reivindicación 1, en donde la combinación de biomarcadores es la combinación del receptor-2 similar a Ig asociado a leucocitos y la alfa-1-glicoproteína ácida.

11. El método de la reivindicación 1, en donde la combinación de biomarcadores es la combinación del receptor-2 similar a Ig asociado a leucocitos y el fragmento de alfa-1-glicoproteína ácida.

12. El método de la reivindicación 1, en donde la combinación de biomarcadores es la combinación del fragmento del receptor-2 similar a Ig asociado a leucocitos y la alfa-1-gücoproteína ácida.

13. El método de la reivindicación 1, en el que la combinación de biomarcadores es la combinación del fragmento del receptor-2 similar a Ig asociado a leucocitos y el fragmento de alfa-1-glicoproteína ácida.

14. El método de la reivindicación 1, 11, 12 o 13, en donde el sujeto no tiene proteinuria.

15. Un método para controlar el progreso de la nefropatía en un sujeto, que comprende:

obtener una primera muestra de orina de un sujeto que padece nefropatía,

determinar en la primera muestra de orina un nivel de un biomarcador o de una combinación de biomarcadores seleccionado del grupo que consiste en:

(i) receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos, y

(¡i) una combinación del receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos y de la alfa- 1-gllcoproteína ácida o uno de sus fragmentos,

en donde el fragmento del receptor-2 similar a Ig asociado a leucocitos es DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) y el fragmento de alfa-1-glicoproteína ácida es

GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2);

obtener una segunda muestra de orina del sujeto 2 semanas a 12 meses después de que se haya obtenido la primera muestra de orina;

determinaren la segunda muestra de orina un nivel del biomarcadoro de la combinación de biomarcadores; y evaluar el progreso de la nefropatía en el sujeto,

en donde un aumento en el nivel del biomarcador o de la combinación de biomarcadores en la segunda muestra de orina, en comparación con la primera muestra de orina, indica que la nefropatía está agravada en el sujeto.

16. El método de la reivindicación 15, en donde el sujeto es un ser humano con nefropatía en fase inicial y la segunda muestra de orina se obtiene 6 a 12 meses después de que se haya obtenido la primera muestra de orina.

17. El método de la reivindicación 15, en donde el sujeto es un ser humano con nefropatía en fase tardía y la segunda muestra de orina se obtiene 3 a 6 meses después de que se haya obtenido la primera muestra de orina.

18. El método de la reivindicación 15, en donde el sujeto es un animal de laboratorio y la segunda muestra de orina se obtiene 2 a 24 semanas después de que se haya obtenido la primera muestra de orina.

19. Un método para controlar la eficacia de un tratamiento de la nefropatía en un sujeto que padece nefropatía, que comprende:

determinar un nivel de un biomarcador o de una combinación de biomarcadores en una muestra de orina del sujeto antes del tratamiento, seleccionándose el biomarcador o la combinación de biomarcadores del grupo que consiste en:

(I) receptor-2 similar a ig asociado a leucocitos o uno de sus fragmentos, y

(¡I) una combinación del receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos y de la alfa- 1-glicoproteína ácida o uno de sus fragmentos,

en donde el fragmento del receptor-2 similar a Ig asociado a leucocitos es DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) y el fragmento de la alfa-1-glicoproteína ácida es

GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2); y

determinar un nivel del biomarcador o de la combinación de biomarcadores en una muestra de orina del sujeto después del tratamiento;

evaluar la eficacia del tratamiento basándose en un cambio del nivel del biomarcador o de la combinación de biomarcadores después del tratamiento,

en donde el tratamiento es eficaz si el nivel del biomarcador o de la combinación de biomarcadores después del tratamiento se mantiene sin cambios o disminuye en comparación con el nivel de antes del tratamiento.

2. Un método para evaluar la toxicidad renal de un agente, que comprende:

obtener una pluralidad de muestras de orina de un sujeto tratado con un agente en diversos momentos durante el tratamiento,

determinar en cada una de las muestras de orina un nivel de un biomarcador o de una combinación de biomarcadores seleccionado del grupo que consiste en:

(i) receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos, y

(ii) una combinación del receptor-2 similar a Ig asociado a leucocitos o uno de sus fragmentos y de la alfa- 1-glicoproteína ácida o uno de sus fragmentos,

en donde el fragmento de receptor-2 similar a Ig asociado a leucocitos es DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) y el fragmento de la alfa-1-glicoproteína ácida es

GQEHFAHLULRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2); y

evaluar la toxicidad renal del agente basándose en un cambio del nivel del biomarcador o de la combinación de 5 biomarcadores durante el tratamiento;

en donde un aumento en el nivel del biomarcador o de la combinación de biomarcadores en el curso del tratamiento Indica que el agente es un tóxico para el riñón.

21. El método de la reivindicación 2, en donde el agente se selecciona del grupo que consiste en un compuesto, un producto de hierbas medicinales y un producto alimenticio.

22. Un kit para el diagnóstico de la nefropatia, que comprende un primer anticuerpo que se une específicamente al

receptor-2 similar a Ig asociado a leucocitos y un segundo anticuerpo que se une específicamente a la alfa-1- glicoproteína ácida.

23. El kit de la reivindicación 22, en donde el primero y segundo anticuerpos son moléculas de ¡nmunoglobulina enteras.

24. El kit de la reivindicación 22, en donde el kit consiste en un primer anticuerpo que se une específicamente al

receptor-2 similar a Ig asociado a leucocitos y un segundo anticuerpo que se une específicamente a la alfa-1- glicoproteína ácida.


 

Patentes similares o relacionadas:

Sistema y procedimiento para pruebas de inmunoensayo de flujo lateral, del 8 de Mayo de 2019, de AMERICAN BIO MEDICA CORPORATION: Un sistema de inmunoensayo de flujo lateral , que comprende: un alojamiento que incluye una porción de cuerpo y una porción de base que tiene […]

Inmunoensayo basado en partículas que usa un agente de unión específica a un analito pegilado, del 8 de Mayo de 2019, de F. HOFFMANN-LA ROCHE AG: Un procedimiento para la medición de un analito en un ensayo de unión específica a un analito basado en micropartículas, en el que dichas micropartículas […]

Detección de CD31 desprendido derivado de plaquetas, del 8 de Mayo de 2019, de INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM): Un fragmento de una proteína CD31 de longitud completa, que comprende al menos una parte del sexto dominio extracelular de tipo inmunoglobulina de dicha proteína […]

Dispositivo de análisis de muestras, del 8 de Mayo de 2019, de Takano Co., Ltd: Un dispositivo de análisis de muestras que comprende: un chip de análisis ; un soporte de chip que permite instalación de un chip […]

Procedimiento para reducir falsos negativos en inmunoensayo para ensayar muestra derivada de biomembrana, del 3 de Mayo de 2019, de DENKA SEIKEN CO., LTD.: Un procedimiento para suprimir un falso negativo en un inmunoensayo para analizar una sustancia diana en una muestra derivada de una membrana mucosa biológica, en […]

Ensayo multiplex para Hepatitis B, del 3 de Mayo de 2019, de BIO-RAD LABORATORIES, INC.: Un kit que comprende: (a) un primer receptáculo que comprende: (i) perlas que se conjugan con antígeno de superficie de Hepatitis B (HBsAg) de humano y marcador […]

Procedimiento de captura de una molécula en una muestra, del 3 de Mayo de 2019, de CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (CNRS): Procedimiento de captura de una molécula en una muestra, que comprende las siguientes etapas: a) la mezcla de dicha muestra con partículas magnéticas, […]

Composiciones, kits y métodos para presentación de antígenos in vitro, evaluación de eficacia de vacunas y evaluación de la inmunotoxicidad de productos biológicos y fármacos, del 1 de Mayo de 2019, de UNIVERSITY OF MIAMI: Método de evaluación de una respuesta de células T frente a una vacuna o un producto biológico, comprendiendo el método las etapas de: a) preparar o proporcionar […]

Otras patentes de INDUSTRIAL TECHNOLOGY RESEARCH INSTITUTE