Anticuerpo anti-NR10 y uso del mismo.

Anticuerpo anti-NR10 que es uno cualquiera de:

(1) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184

(H30, H44) y una región variable de cadenaligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17);

(2) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 196, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H28, H42) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17);

(3) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 197, CDR3 de SEQ ID NO: 184 (H34, H46) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17);

(4) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H57, H78) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17);

(5) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H71, H92) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); y

(6) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 199 y CDR3 de SEQ ID NO: 184 (H97, H98) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 203, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L50).

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/JP2009/070376.

Solicitante: CHUGAI SEIYAKU KABUSHIKI KAISHA.

Nacionalidad solicitante: Japón.

Dirección: 5-1, Ukima 5-chome Kita-ku, Tokyo 115-8543 JAPON.

Inventor/es: TSUNODA,Hiroyuki , IGAWA,Tomoyuki , KURAMOCHI,TAICHI, SHIRAIWA,HIROTAKE, TACHIBANA,TATSUHIKO, KASUTANI,KEIKO, OHYAMA,SOUHEI, ESAKI,KEIKO.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/28 (contra receptores, antígenos celulares de superficie o determinantes celulares de superficie)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Técnicas de mutación o de ingeniería genética;... > C12N15/09 (Tecnología del ADN recombinante)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P29/00 (Agentes analgésicos, antipiréticos o antiinflamatorios que no actúan sobre el sistema nervioso central, p. ej. agentes antirreumáticos; Antiinflamatorios no esteroideos (AINEs))
google+ twitter facebook

Texto extraído del PDF original:

DESCRIPCIÓN

Anticuerpo anti-NR10 y uso del mismo

Campo técnico

La presente invención se refiere a anticuerpos anti-NR10, y a composiciones farmacéuticas que comprenden un anticuerpo anti-NR10.

Antecedentes de la técnica

Se conocen muchas citocinas como factores humorales implicados en el crecimiento y la diferenciación de diversos tipos de células, o en la activación de funciones de células maduras diferenciadas. Las células estimuladas con citocinas producen diferentes tipos de citocinas, formando de ese modo redes de múltiples citocinas en el cuerpo. La homeostasis biológica se mantiene mediante un delicado equilibrio de la regulación mutua entre citocinas en estas redes. Se cree que muchas enfermedades inflamatorias resultan del fallo de tales redes de citocinas. Por tanto, la terapia anti-citocinas basada en anticuerpos monoclonales está atrayendo mucha atención. Por ejemplo, se ha demostrado que anticuerpos anti-TNF y anticuerpos anti-receptor de IL-6 son altamente eficaces clínicamente. Por otro lado, hay muchos ejemplos de fallos en los que no se produjeron efectos terapéuticos cuando se bloqueo sola una única citocina, tal como IL-4, debido a la activación de rutas compensatorias en estados patológicos reales.

La presente invención tuvo éxito en aislar un receptor de citocinas novedoso, NR10, que era altamente homólogo a gp130, un receptor para la transducción de señales de IL-6 (documento de patente 1). NR10 forma un heterodímero con el receptor de oncostatina M (OSMR) y funciona como receptor de IL-31 (documento no de patente 1). Con respecto a IL-31, se ha notificado que ratones transgénicos que sobreexpresan IL-31 desarrollan espontáneamente dermatitis prurítica (documento de patente 2).

Anticuerpos que se unen a NR10 e inhiben la unión entre NR10 e IL-31 pueden ser eficaces en el tratamiento de enfermedades inflamatorias. Para uso clínico, se requiere que los anticuerpos anti-NR10 tengan baja inmunogenicidad. Además, con el fin de lograr altos efectos terapéuticos, se desean anticuerpos con fuerte actividad de neutralización de o unión a NR10. Por ejemplo, se describieron anticuerpos neutralizantes de ratón anti-NR10 para su uso en el tratamiento de enfermedades inflamatorias (documento de patente 3).

Se describen a continuación documentos de la técnica anterior de la presente invención.

Documento de patente 1: WO00/75314.

Documento de patente 2: WO03/060090.

Documento de patente 3: WO 2007/142325 Documento no de patente 1: IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing cells T in patients with atopic dermatitis, J Allergy Clin Immunol. Febrero de 2006; 117(2): 418-25.

Divulgación de la invención

[Problemas que van a solucionarse mediante la invención] La presente invención se consiguió en vista de las circunstancias descritas anteriormente. Un objetivo de la presente invención es proporcionar anticuerpos anti-NR10, y composiciones farmacéuticas que comprenden un anticuerpo anti-NR10.

[Medios para solucionar los problemas] Los presentes inventores realizaron estudios específicos para conseguir el objetivo descrito anteriormente. Los presentes inventores tuvieron éxito en la obtención de anticuerpos anti-NR10 que tienen una actividad de neutralización eficaz contra NR10. Además, los presentes inventores tuvieron éxito en la humanización de los anticuerpos al mismo tiempo que mantenían su actividad. Los presentes inventores también produjeron de manera satisfactoria anticuerpos con farmacocinética mejorada, actividad de unión a antígeno potenciada, estabilidad mejorada y/o riesgo reducido de inmunogenicidad. Estos anticuerpos son útiles como agentes terapéuticos para enfermedades inflamatorias.

La presente invención se refiere a anticuerpos anti-NR10, y a composiciones farmacéuticas que comprenden un anticuerpo anti-NR10. Más específicamente, la presente invención incluye: [1.] Un anticuerpo anti-NR10 que es uno cualquiera de: (1) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H30, H44) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L 17); (2) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 196, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H28, H42) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); (3) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 197, CDR3 de SEQ ID NO: 184 (H34, H46) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); (4) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H57, H78) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); (5) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H71, H92) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); y (6) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 199 y CDR3 de SEQ ID NO: 184 (H97, H98) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 203, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L50).

[2.] El anticuerpo anti-NR10 de [1], que es uno cualquiera de: (1) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 210 (H44) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H44L17); (2) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 207 (H30) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H30L17); (3) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 209 (H42) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H42L17); (4) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 206 (H28) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H28L17); (5) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 211 (H46) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H46L17); (6) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 208 (H34) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H34L17); (7) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 214 (H78) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H78L17); (8) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 212 (H57) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H57L17); (9) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 215 (H92) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H92L17); (10) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 213 (H71) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H71L17); (11) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 217 (H98) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 221 (L50) (H98L50); y (12) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 216 (H97) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 221 (L50) (H97L50).

[3.] El anticuerpo anti-NR10 de [1] o [2], que es un anticuerpo humanizado.

[4.] El anticuerpo anti-NR10 de [2], que es uno cualquiera de: (1) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 228 (H44) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H44L17); (2) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 225 (H30) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H30L17); (3) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 227 (H42) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H42L17); (4) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 224 (H28) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H28L17); (5) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 229 (H46) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H46L 17); (6) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 226 (H34) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L 17) (H34L17); (7) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 232 (H78) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H78L17); (8) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 230 (H57) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H57L17); (9) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 233 (H92) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H92L17); (10) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 231 (H71) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H71L17); (11) un anticuerpo que comprende una cadena pesada la secuencia de aminoácidos de SEQ ID NO: 235 (H98) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 239 (L50) (H98L50); y (12) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 234 (H97) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 239 (L50) (H97L50).

[5.] Una composición farmacéutica que comprende el anticuerpo anti-NR10 de uno cualquiera de [1] a [4].

[6.] El anticuerpo anti-NR10 de uno cualquiera de [1] a [4] para su uso en el tratamiento de una enfermedad inflamatoria.

[7.] Uso del anticuerpo anti-NR10 de uno cualquiera de [1] a [4] en la fabricación de un medicamento para el tratamiento de una enfermedad inflamatoria.

Breve descripción de los dibujos

La figura 1 muestra las secuencias de aminoácidos de las regiones variables de cadena pesada de los anticuerpos de ratón NS18, NS22, NS23 y NS33.

La figura 2 muestra las secuencias de aminoácidos de las regiones variables de cadena ligera de los anticuerpos de ratón NS18, NS22, NS23 y NS33.

La figura 3 es un gráfico que muestra la inhibición del crecimiento de células hNR10/hOSMR/BaF3 mediante sobrenadantes de cultivo de hibridomas.

La figura 4 es un gráfico que muestra la inhibición del crecimiento de células cynNR10/cynOSMR/BaF3 mediante sobrenadantes de cultivo de hibridomas.

La figura 5 es un gráfico que muestra la evaluación de la actividad de NS22 quimérico (BaF).

La figura 6 es un gráfico que muestra la evaluación de la actividad de NS22 quimérico (DU-145).

La figura 7 es un gráfico que muestra la evaluación de la competencia de NS22 quimérico con IL-31.

La figura 8 es un gráfico que muestra la actividad de unión competitiva a NR10 de anticuerpos anti-NR10.

La figura 9 es un conjunto de gráficos que muestran la evaluación de la competencia de NS22 humanizado (H0L0) con IL-31.

La figura 10 muestra el efecto de la región constante de anticuerpo anti-NR10 humanizado H0L0 sobre la heterogeneidad evaluado mediante cromatografía de intercambio catiónico.

La figura 11 es un conjunto de gráficos que muestran la evaluación de la competencia de mutantes del anticuerpo anti-NR10 humanizado cuyo punto isoeléctrico de las regiones variables se reduce sin pérdida significativa de la unión a NR10, con IL-31.

La figura 12 muestra el efecto de la región constante del anticuerpo anti-receptor de IL-6 sobre la heterogeneidad evaluada mediante cromatografía de intercambio catiónico.

La figura 13 muestra el efecto de la región constante del anticuerpo anti-receptor de IL-6 sobre el pico de desnaturalización evaluado mediante DSC.

La figura 14 muestra el efecto de la región constante novedosa M14 sobre la heterogeneidad en un anticuerpo anti- receptor de IL-6, evaluado mediante cromatografía de intercambio catiónico.

La figura 15 muestra el efecto de la región constante novedosa M58 sobre la heterogeneidad en un anticuerpo anti- receptor de IL-6, evaluado mediante cromatografía de intercambio catiónico.

La figura 16 muestra el efecto de la región constante novedosa M58 sobre el pico de desnaturalización en un anticuerpo anti-receptor de IL-6, evaluado mediante DSC.

La figura 17 muestra el resultado de someter a ensayo la retención de huPM1-IgG1 y huPM1-M58 en el plasma de ratones transgénicos para FcRn humano.

La figura 18 muestra la actividad biológica de cada anticuerpo evaluada usando BaF/NR10.

La figura 19 muestra el análisis de muestras aceleradas térmicamente (línea discontinua) y no aceleradas (línea continua) de cada anticuerpo modificado mediante cromatografía de intercambio catiónico para comparar la generación de productos de degradación entre antes y después de la aceleración térmica. La flecha indica la posición del pico del componente básico que se alteró.

La figura 20 es un conjunto de gráficos que muestran la evaluación (BaF) de la actividad de cada variante.

La figura 21 es un gráfico que muestra la evaluación (BaF) de la actividad de Ha401La402 y H0L0.

La figura 22 es un gráfico que muestra la evaluación (BaF) de la actividad de H17L11 y H0L0.

La figura 23 es un gráfico que muestra la evaluación (BaF) de la actividad de H19L12 y H0L0.

La figura 24 es un gráfico que muestra la actividad biológica de H0L12 y H0L17 evaluada usando BaF/NR10.

La figura 25-1 es un conjunto de gráficos que muestran la evaluación (BaF) de la actividad de cada variante.

La figura 25-2 es una continuación de la figura 25-1.

La figura 26 es un diagrama esquemático de NR10-ECD silvestre y quimérico de ser humano/ratón.

La figura 27 es un conjunto de fotografías que muestran la detección del dominio de unión mediante inmunotransferencia de tipo Western. A es una fotografía que muestra el resultado de la detección usando un anticuerpo humanizado anti-NR10 humano; B es una fotografía que muestra el resultado de la detección usando un anticuerpo de ratón anti-NR10 humano; y C es una fotografía que muestra el resultado de la detección usando un anticuerpo anti-Myc. Con el anticuerpo anti-NR10 humano se detectó un antígeno de unión sólo en hhh, hhm y hmm, pero no en mmm, mmh y mhm.

La figura 28-1 muestra la secuencia de aminoácidos de cada variante de H0 (SEQ ID NO: 50).

La figura 28-2 es una continuación de la figura 28-1.

La figura 28-3 es una continuación de la figura 28-2.

La figura 29-1 muestra la secuencia de aminoácidos de cada variante de L0 (SEQ ID NO: 52).

La figura 29-2 es una continuación de la figura 29-1.

Modo para llevar a cabo la invención

NR10 NR10 es una proteína que forma un heterodímero con el receptor de oncostatina M (OSMR) y funciona como receptor de IL-31. NR10 también se conoce como glm-r (J Biol Chem 277, 16831-6, 2002), GPL (J Biol Chem 278, 49850-9, 2003), IL31RA (Nat Immunol 5, 752-60, 2004), y similares. Por tanto, NR10 tal como se da a conocer en el presente documento también incluye proteínas nombradas mediante tales nombres.

Tal como se da a conocer en el presente documento, NR10 (también denominado IL31RA, GPL o glm-r) no está particularmente limitado en cuanto a su origen, e incluye los derivados de seres humanos, ratones, monos y otros mamíferos. Se prefiere NR10 derivado de seres humanos, ratones y monos, y se prefiere particularmente NR10 derivado de seres humanos.

Hay múltiples variantes de corte y empalme de NR10 derivado de seres humanos (documento WO 00/075314). De las variantes de corte y empalme descritas anteriormente, NR10.1 consiste en 662 aminoácidos y contiene un dominio transmembrana. NR10.2 es una proteína de tipo receptor soluble que consiste en 252 aminoácidos sin el dominio transmembrana. Mientras tanto, las variantes de corte y empalme de NR10 conocidas que funcionan como proteínas receptoras transmembrana incluyen NR10.3 e IL-31RAv3. El NR10 humano tal como se da a conocer en el presente documento no está particularmente limitado, siempre que forme un heterodímero con el receptor de oncostatina M (OSMR) y funcione como receptor de IL-31. NR10 preferido incluye NR10.3 (también denominado ILRAv4 (Nat Immunol 5,752-60, 2004)) e IL-31RAv3. NR 10.3 (IL31RAv4) consiste en 662 aminoácidos (documento WO 00/075314; Nat Immunol 5, 752-60, 2004) e IL31RAv3 consiste en 732 aminoácidos (n.º de registro de GenBank: NM139017). La secuencia de aminoácidos de IL31RAv4 se muestra en SEQ ID NO: 79, y la secuencia de aminoácidos de IL31RAv3 se muestra en SEQ ID NO: 80. Mientras tanto, NR10 derivado de ratón incluye proteínas que comprenden la secuencia de aminoácidos de SEQ ID NO: 81. Además, NR10 derivado de macaco cangrejero incluye proteínas que comprenden la secuencia de aminoácidos de SEQ ID NO: 66.

Anticuerpos (secuencias) El anticuerpo anti-NR10 preferido tal como se da a conocer en el presente documento incluye los anticuerpos anti- NR10 de uno cualquiera de (1) a (8) en de (A) a (D) a continuación.

(A) NS 18 (1) anticuerpos que tienen una región variable de cadena pesada que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 1 (HCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 2 (HCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 3 (HCDR3); (2) anticuerpos que tienen la región variable de cadena pesada de SEQ ID NO: 4 (VH); (3) anticuerpos que tienen una región variable de cadena ligera que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 5 (LCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 6 (LCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 7 (LCDR3); (4) anticuerpos que tienen la región variable de cadena ligera de SEQ ID NO: 8 (VL); (5) anticuerpos que tienen la región variable de cadena pesada de (1) y la región variable de cadena ligera de (3); (6) anticuerpos que tienen la región variable de cadena pesada de (2) y la región variable de cadena ligera de (4); (7) anticuerpos en los que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en los anticuerpos de uno cualquiera de (1) a (6), que tienen una actividad equivalente a la de los anticuerpos de uno cualquiera de (1) a (6); y (8) anticuerpos que se unen al mismo epítopo que un epítopo al que se unen los anticuerpos de uno cualquiera de (1) a (7).

(B) NS22 (1) anticuerpos que tienen una región variable de cadena pesada que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 9 (HCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 (HCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 (HCDR3); (2) anticuerpos que tienen la región variable de cadena pesada de SEQ ID NO: 12 (VH); (3) anticuerpos que tienen una región variable de cadena ligera que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 (LCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 14 (LCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 15 (LCDR3); (4) anticuerpos que tienen la región variable de cadena ligera de SEQ ID NO: 16 (VL); (5) anticuerpos que tienen la región variable de cadena pesada de (1) y la región variable de cadena ligera de (3); (6) anticuerpos que tienen la región variable de cadena pesada de (2) y la región variable de cadena ligera de (4); (7) anticuerpos en los que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en los anticuerpos de uno cualquiera de (1) a (6), que tienen una actividad equivalente a la de los anticuerpos de uno cualquiera de (1) a (6); y (8) anticuerpos que se unen al mismo epítopo que un epítopo al que se unen los anticuerpos de uno cualquiera de (1) a (7).

Los ejemplos específicos de la sustitución, deleción, adición y/o inserción descritas anteriormente de uno o más aminoácidos no están particularmente limitados e incluyen, por ejemplo, las siguientes modificaciones.

Sustitución de Ile en la posición 3 en la CDR1 de cadena pesada de SEQ ID NO: 9 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Val.

Sustitución de Met en la posición 4 en la CDR1 de cadena pesada de SEQ ID NO: 9 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Ile.

Sustitución de Met en la posición 4 en la CDR1 de cadena pesada de SEQ ID NO: 9 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Leu.

Sustitución de Ile en la posición 3 en la CDR1 de cadena pesada de SEQ ID NO: 9 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Ala.

Sustitución de Leu en la posición 1 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Glu.

Sustitución de Asn en la posición 3 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Gln en la posición 13 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Lys en la posición 14 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Gln.

Sustitución de Lys en la posición 16 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Gln.

Sustitución de Gly en la posición 17 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Lys y Gly en las posiciones 16 y 17, respectivamente, en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Lys en la posición 16 por Gln, y Gly en la posición 17 por Asp.

Sustitución de Lys, Lys y Gly en las posiciones 14, 16 y 17, respectivamente, en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Lys en la posición 14 por Gln, Lys en la posición 16 por Gln y Gly en la posición 17 por Asp.

Sustitución de Gln, Lys, Lys y Gly en las posiciones 13, 14, 16 y 17, respectivamente, en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Gln en la posición 13 por Asp, Lys en la posición 14 por Gln, Lys en la posición 16 por Gln y Gly en la posición 17 por Asp.

Sustitución de Ser en la posición 10 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Gln en la posición 13 en la CDR2 de cadena pesada de SEQ ID NO: 10 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Pro.

Sustitución de Tyr en la posición 3 en la CDR3 de cadena pesada de SEQ ID NO: 11 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Leu.

Sustitución de Met en la posición 10 en la CDR3 de cadena pesada de SEQ ID NO: 11 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Leu.

Sustitución de Asp en la posición 11 en la CDR3 de cadena pesada de SEQ ID NO: 11 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Glu.

Sustitución de Tyr en la posición 12 en la CDR3 de cadena pesada de SEQ ID NO: 11 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Thr y Ser.

Sustitución de Met, Asp y Tyr en las posiciones 10, 11 y 12, respectivamente, en la CDR3 de cadena pesada de SEQ ID NO: 11 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Met en la posición 10 por Leu, Asp en la posición 11 por Glu y Tyr en la posición 12 por Thr.

Sustitución de Asp y Tyr en las posiciones 11 y 12, respectivamente, en la CDR3 de cadena pesada de SEQ ID NO: 11 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Asp en la posición 11 por Glu y Tyr en la posición 12 por Thr.

Sustitución de Tyr, Asp y Tyr en las posiciones 3, 11 y 12, respectivamente, en la CDR3 de cadena pesada de SEQ ID NO: 11 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Tyr en la posición 3 por Leu, Asp en la posición 11 por Glu y Tyr en la posición 12 por Thr o Ser.

Sustitución de Arg en la posición 1 en la CDR1 de cadena ligera de SEQ ID NO: 13 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Gln.

Sustitución de Asn en la posición 5 en la CDR1 de cadena ligera de SEQ ID NO: 13 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Arg y Asn en las posiciones 1 y 5, respectivamente, en la CDR1 de cadena ligera de SEQ ID NO: 13 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Arg en la posición 1 por Gln y Asn en la posición 5 por Asp.

Sustitución de Ser en la posición 8 en la CDR1 de cadena ligera de SEQ ID NO: 13 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Arg.

Sustitución de Leu en la posición 10 en la CDR1 de cadena ligera de SEQ ID NO: 13 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Val.

Sustitución de Ser y Leu en las posiciones 8 y 10, respectivamente, en la CDR1 de cadena ligera de SEQ ID NO: 13 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Ser en la posición 8 por Arg y Leu en la posición 10 por Val.

Sustitución de Thr en la posición 2 en la CDR1 de cadena ligera de SEQ ID NO: 13 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Ala y Ser.

Sustitución de Asn en la posición 1 en la CDR2 de cadena ligera de SEQ ID NO: 14 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Lys en la posición 3 en la CDR2 de cadena ligera de SEQ ID NO: 14 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Gln.

Sustitución de Leu en la posición 5 en la CDR2 de cadena ligera de SEQ ID NO: 14 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Glu.

Sustitución de Lys en la posición 7 en la CDR2 de cadena ligera de SEQ ID NO: 14 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Gln y Asp.

Sustitución de Lys, Leu y Lys en las posiciones 3, 5 y 7, respectivamente, en la CDR2 de cadena ligera de SEQ ID NO: 14 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos incluyen sustitución de Lys en la posición 3 por Gln, Leu en la posición 5 por Glu y Lys en la posición 7 por Gln.

Sustitución de Glu en la posición 5 en la CDR3 de cadena ligera de SEQ ID NO: 15 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Ser en la posición 6 en la CDR3 de cadena ligera de SEQ ID NO: 15 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Asp.

Sustitución de Thr en la posición 9 en la CDR3 de cadena ligera de SEQ ID NO: 15 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado pero los ejemplos preferidos del mismo incluyen Phe.

Cada una de las sustituciones descritas anteriormente puede hacerse sola, o pueden hacerse múltiples sustituciones en combinación. Además, las sustituciones anteriores pueden combinarse con otras sustituciones. Estas sustituciones pueden mejorar la farmacocinética del anticuerpo (retención en plasma), potenciar la actividad de unión a antígeno, mejorar la estabilidad y/o reducir el riesgo de inmunogenicidad.

Tal como se da a conocer en el presente documento, los ejemplos específicos de las regiones variables que tienen una combinación de las sustituciones descritas anteriormente incluyen, por ejemplo, regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 167 y regiones variables de cadena ligera que tienen la secuencia de aminoácidos de SEQ ID NO: 168. Además, los ejemplos de los anticuerpos que tienen una combinación de las sustituciones descritas anteriormente incluyen, por ejemplo, anticuerpos que comprenden una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 167 y una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 168.

Además, ejemplos específicos de regiones variables de cadena pesada o cadena ligera que tienen una combinación de las sustituciones descritas anteriormente incluyen, por ejemplo, las siguientes regiones variables: (a) regiones variables de cadena pesada que comprenden CDR1 de SEQ ID NO: 196, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 11 (H17); (b) regiones variables de cadena pesada que comprenden CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 11 (H19); (c) regiones variables de cadena pesada que comprenden CDR1 de SEQ ID NO: 196, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H28, H42); (d) regiones variables de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H30, H44); (e) regiones variables de cadena pesada que comprenden CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H34, H46); (f) regiones variables de cadena pesada que comprenden CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H57, H78); (g) regiones variables de cadena pesada que comprenden CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H71, H92); (h) regiones variables de cadena pesada que comprenden CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 199 y CDR3 de SEQ ID NO: 184 (H97, H98); (i) regiones variables de cadena ligera que comprenden CDR1 de SEQ ID NO: 200, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L11); (j) regiones variables de cadena ligera que comprenden CDR1 de SEQ ID NO: 201, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L12); (k) regiones variables de cadena ligera que comprenden CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); y (l) regiones variables de cadena ligera que comprenden CDR1 de SEQ ID NO: 203, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L50).

Además, los ejemplos específicos de los anticuerpos que tienen una combinación de las sustituciones descritas anteriormente incluyen, por ejemplo: (i) anticuerpos que comprenden la región variable de cadena pesada de (c) y la región variable de cadena ligera de (k); (ii) anticuerpos que comprenden la región variable de cadena pesada de (d) y la región variable de cadena ligera de (k); (iii) anticuerpos que comprenden la región variable de cadena pesada de (e) y la región variable de cadena ligera de (k); (iv) anticuerpos que comprenden la región variable de cadena pesada de (f) y la región variable de cadena ligera de (k); (v) anticuerpos que comprenden la región variable de cadena pesada de (g) y la región variable de cadena ligera de (k); y (vi) anticuerpos que comprenden la región variable de cadena pesada de (h) y la región variable de cadena ligera de (l).

(C) NS23 (1) anticuerpos que tienen una región variable de cadena pesada que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 17 (HCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 18 (HCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 19 (HCDR3); (2) anticuerpos que tienen la región variable de cadena pesada de SEQ ID NO: 20 (VH); (3) anticuerpos que tienen una región variable de cadena ligera que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 21 (LCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 22 (LCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 23 (LCDR3); (4) anticuerpos que tienen la región variable de cadena ligera de SEQ ID NO: 24 (VL); (5) anticuerpos que tienen la región variable de cadena pesada de (1) y la región variable de cadena ligera de (3); (6) anticuerpos que tienen la región variable de cadena pesada de (2) y la región variable de cadena ligera de (4); (7) anticuerpos en los que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en los anticuerpos de uno cualquiera de (1) a (6), que tienen una actividad equivalente a la de los anticuerpos de uno cualquiera de (1) a (6); y (8) anticuerpos que se unen al mismo epítopo que un epítopo al que se unen los anticuerpos de uno cualquiera de (1) a (7).

(D) NS33 (1) anticuerpos que tienen una región variable de cadena pesada que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 25 (HCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 26 (HCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 27 (HCDR3); (2) anticuerpos que tienen la región variable de cadena pesada de SEQ ID NO: 28 (VH); (3) anticuerpos que tienen una región variable de cadena ligera que comprende CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 29 (LCDR1), CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 30 (LCDR2) y CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 31 (LCDR3); (4) anticuerpos que tienen la región variable de cadena ligera de SEQ ID NO: 32 (VL); (5) anticuerpos que tienen la región variable de cadena pesada de (1) y la región variable de cadena ligera de (3); (6) anticuerpos que tienen la región variable de cadena pesada de (2) y la región variable de cadena ligera de (4); (7) anticuerpos en los que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en los anticuerpos de uno cualquiera de (1) a (6), que tienen una actividad equivalente a la de los anticuerpos de uno cualquiera de (1) a (6); y (8) anticuerpos que se unen al mismo epítopo que un epítopo al que se unen los anticuerpos de uno cualquiera de (1) a (7).

Puede usarse cualquier región de marco (FR) para los anticuerpos descritos anteriormente de (1) o (3); sin embargo, se usan preferiblemente FR derivadas de ser humano. Además, puede usarse cualquier región constante para los anticuerpos descritos anteriormente de (1) a (8); sin embargo, se usan preferiblemente regiones constantes derivadas de ser humano. Para los anticuerpos dados a conocer en el presente documento, la secuencia de aminoácidos de la FR o región constante original puede usarse sin modificación, o tras modificarse para dar una secuencia de aminoácidos diferente mediante sustitución, deleción, adición y/o inserción de uno o más aminoácidos.

La secuencia de aminoácidos de la cadena pesada del NS18 descrito anteriormente se muestra en SEQ ID NO: 34 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 33. Mientras tanto, la secuencia de aminoácidos de la cadena ligera se muestra en SEQ ID NO: 36 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 35.

La secuencia de aminoácidos de la cadena pesada de NS22 se muestra en SEQ ID NO: 38 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 37. Mientras tanto, la secuencia de aminoácidos de la cadena ligera se muestra en SEQ ID NO: 40 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 39.

La secuencia de aminoácidos de la cadena pesada de NS23 se muestra en SEQ ID NO: 42 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 41. Mientras tanto, la secuencia de aminoácidos de la cadena ligera se muestra en SEQ ID NO: 44 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 43.

La secuencia de aminoácidos de la cadena pesada de NS33 se muestra en SEQ ID NO: 46 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 45. Mientras tanto, la secuencia de aminoácidos de la cadena ligera se muestra en SEQ ID NO: 48 y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 47.

Tal como se da a conocer en el presente documento, la “actividad equivalente a la del anticuerpo de uno cualquiera de (1) a (6)” significa que la actividad de unión y/o neutralización de NR10 (por ejemplo, NR10 humano) es equivalente. Tal como se da a conocer en el presente documento, el término “equivalente” significa que la actividad no es necesariamente la misma sino que puede potenciarse o reducirse siempre que se retenga la actividad. Los anticuerpos con una actividad reducida incluyen, por ejemplo, anticuerpos que tienen una actividad que es el 30% o más, preferiblemente el 50% o más, y más preferiblemente el 80% o más de la del anticuerpo original.

Los anticuerpos de uno cualquiera de (1) a (6) mencionados anteriormente pueden tener una sustitución, deleción, adición y/o inserción de uno o más aminoácidos en la secuencia de aminoácidos de las regiones variables (secuencias de CDR y/o secuencias de FR), siempre que se retenga la actividad de neutralización de y/o unión a NR10. Los métodos bien conocidos por los expertos en la técnica para preparar la secuencia de aminoácidos de un anticuerpo que tiene una sustitución, deleción, adición y/o inserción de uno o más aminoácidos en la secuencia de aminoácidos y retiene la actividad de neutralización de y/o unión a NR10 incluyen métodos para introducir mutaciones en proteínas. Por ejemplo, los expertos en la técnica pueden preparar mutantes funcionalmente equivalentes al anticuerpo que tiene actividad de neutralización de y/o unión a NR10 introduciendo mutaciones apropiadas en la secuencia de aminoácidos del anticuerpo que tiene actividad de neutralización de y/o unión a NR10 usando mutagénesis dirigida al sitio (Hashimoto-Gotoh, T, Mizuno, T, Ogasahara, Y, y Nakagawa, M. (1995) An oligodeoxiribonucleotide-directed dual amber method for site-directed mutagenesis. Gene 152, 271-275, Zoller, MJ, y Smith, M. (1983) Oligonucleotide-directed mutagenesis of DNA fragments cloned in M13 vectors. Methods Enzymol. 100, 468-500, Kramer, W, Drutsa, V, Jansen, HW, Kramer, B, Pflugfelder, M, y Fritz, HJ (1984) The gapped duplex DNA approach to oligonucleotide-directed mutation construction. Nucleic Acids Res. 12, 9441-9456, Kramer W, y Fritz HJ (1987) Oligonucleotide-directed construction of mutations via gapped duplex DNA Methods. Enzymol. 154, 350-367, Kunkel, TA (1985) Rapid and effcient site-specific mutagenesis with out fenotypic selection. Proc Natl Acad Sci USA. 82, 488-492) o similares. Por tanto, también se incluyen en el anticuerpo de la presente invención anticuerpos que contienen una o más mutaciones de aminoácido en las regiones variables y tienen actividad de neutralización de y/o unión a NR10.

Cuando se altera un residuo de aminoácido, el aminoácido se muta preferiblemente para dar un(os) aminoácido(s) diferente(s) que conserva(n) las propiedades de la cadena lateral del aminoácido. Ejemplos de propiedades de cadenas laterales de aminoácidos son: aminoácidos hidrófobos (A, I, L, M, F, P, W, Y y V), aminoácidos hidrófilos (R, D, N, C, E, Q, G, H, K, S y T), aminoácidos que contienen cadenas laterales alifáticas (G, A, V, L, I y P), aminoácidos que contienen cadenas laterales que contienen grupo hidroxilo (S, T y Y), aminoácidos que contienen cadenas laterales que contienen azufre (C y M), aminoácidos que contienen cadenas laterales que contienen ácido carboxílico y amida (D, N, E, y Q), aminoácidos que contienen cadenas laterales básicas (R, K y H) y aminoácidos que contienen cadenas laterales aromáticas (H, F, Y y W) (los aminoácidos se representan mediante códigos de una letra entre paréntesis). Las sustituciones de aminoácido dentro de cada grupo se denominan sustituciones conservativas. Se sabe ya que un polipéptido que contiene una secuencia de aminoácidos modificada en la que uno o más residuos de aminoácido en una secuencia de aminoácidos dada se delecionan, añaden y/o sustituyen por otros aminoácidos puede retener la actividad biológica original (Mark, D. F. et al., Proc. Natl. Acad. Sci. USA; (1984) 81:5662-6; Zoller, M. J. y Smith, M., Nucleic Acids Res. (1982) 10:6487-500; Wang, A. et al., Science (1984) 224:1431-3; Dalbadie-McFarland, G. et al., Proc. Natl. Acad. Sci. USA (1982) 79:6409-13). Tales mutantes tienen una identidad de aminoácidos de al menos el 70%, más preferiblemente al menos el 75%, incluso más preferiblemente al menos el 80%, todavía más preferiblemente al menos el 85%, aún más preferiblemente al menos el 90% y lo más preferiblemente al menos el 95%, con las regiones variables (por ejemplo, secuencias de CDR, secuencias de FR, o regiones variables completas) tal como se da a conocer en el presente documento. En el presente documento, la identidad de secuencia se define como el porcentaje de residuos idénticos a aquellos en la secuencia de aminoácidos original de la región variable de cadena pesada o región variable de cadena ligera, determinado tras alinearse las secuencias e introducirse apropiadamente huecos para maximizar la identidad de secuencia según sea necesario. La identidad de secuencias de aminoácidos puede determinarse mediante el método descrito a continuación.

Alternativamente, las secuencias de aminoácidos de regiones variables que tienen una sustitución, deleción, adición y/o inserción de uno o más aminoácidos en la secuencia de aminoácidos de las regiones variables (secuencias de CDR y/o secuencias de FR) y retienen la actividad de neutralización de y/o unión a NR10 pueden obtenerse a partir de ácidos nucleicos que se hibridan en condiciones rigurosas con ácido nucleico compuesto por la secuencia de nucleótidos que codifica para la secuencia de aminoácidos de las regiones variables. Las condiciones de hibridación rigurosas para aislar un ácido nucleico que se hibrida en condiciones rigurosas con un ácido nucleico que incluye la secuencia de nucleótidos que codifica para la secuencia de aminoácidos de las regiones variables incluyen, por ejemplo, las condiciones de urea 6 M, SDS al 0,4%, 0,5x SSC y 37ºC, o condiciones de hibridación con rigurosidades equivalentes a las mismas. Con condiciones más rigurosas, por ejemplo, las condiciones de urea 6 M, SDS al 0,4%, 0,1 x SSC y 42ºC, puede esperarse el aislamiento de ácidos nucleicos con una homología mucho mayor. Las secuencias de los ácidos nucleicos aislados pueden determinarse mediante los métodos conocidos descritos a continuación. La homología de la secuencia de nucleótidos global del ácido nucleico aislado es de al menos el 50%, o una identidad de secuencia mayor, preferiblemente del 70% o mayor, más preferiblemente del 90% o mayor (por ejemplo, el 95%, el 96%, el 97%, el 98%, el 99% o mayor).

También pueden aislarse ácidos nucleicos que se hibridan en condiciones rigurosas con un ácido nucleico compuesto por la secuencia de nucleótidos que codifica para la secuencia de aminoácidos de las regiones variables usando, en lugar de los métodos descritos anteriormente que usan técnicas de hibridación, métodos de amplificación génica tales como reacción en cadena de la polimerasa (PCR) usando cebadores sintetizados basándose en la información de la secuencia de nucleótidos que codifica para la secuencia de aminoácidos de las regiones variables.

Específicamente, la identidad de una secuencia de nucleótidos o secuencia de aminoácidos con otra puede determinarse usando el algoritmo BLAST, de Karlin y Altschul (Proc. Natl. Acad. Sci. USA (1993) 90, 5873-7). Se desarrollaron programas tales como BLASTN y BLASTX basándose en este algoritmo (Altschul et al., J. Mol. Biol. (1990) 215,403-10). Para analizar secuencias de nucleótidos según BLASTN basado en BLAST, se fijan los parámetros, por ejemplo, como puntuación = 100 y longitud de palabra = 12. Por otro lado, los parámetros usados para el análisis de secuencias de aminoácidos mediante BLASTX basado en BLAST incluyen, por ejemplo, puntuación = 50 y longitud de palabra = 3. Se usan parámetros por defecto para cada programa cuando se usan los programas BLAST y Gapped BLAST. Se conocen en la técnica técnicas específicas para tales análisis (véase el sitio web del National Center for Biotechnology Information (NCBI), Basic Local Alignment Search Tool (BLAST); http://www.ncbi.nlm.nih.gov).

También se dan a conocer anticuerpos que se unen al mismo epítopo que un epítopo al que se unen los anticuerpos de uno cualquiera de (1) a (7).

Si un anticuerpo reconoce el mismo epítopo que el reconocido por otro anticuerpo puede confirmarse mediante la competencia entre los dos anticuerpos por el epítopo. La competencia entre los anticuerpos puede evaluarse mediante ensayos de unión competitiva usando medios tales como ELISA, método de transferencia de energía de fluorescencia (FRET) y tecnología de ensayo de microvolumen fluorométrico (FMAT(R)). La cantidad de anticuerpos unidos a un antígeno se correlaciona indirectamente con la capacidad de unión de anticuerpos competidores candidatos (anticuerpos de prueba) que se unen de manera competitiva al mismo epítopo. En otras palabras, a medida que la cantidad de o la afinidad de anticuerpos de prueba contra el mismo epítopo aumenta, la cantidad de anticuerpos unidos al antígeno disminuye, y la cantidad de anticuerpos de prueba unidos al antígeno aumenta. Específicamente, se añaden simultáneamente a los antígenos anticuerpos marcados apropiadamente y anticuerpos que van a evaluarse, y se detectan los anticuerpos así unidos usando el marcador. La cantidad de anticuerpos unidos al antígeno puede determinarse fácilmente marcando los anticuerpos de antemano. Este marcador no está particularmente limitado, y el método de marcaje se selecciona según la técnica de ensayo usada. El método de marcaje incluye marcaje fluorescente, radiomarcaje, marcaje enzimático, y similares.

Por ejemplo, se añaden simultáneamente anticuerpos marcados fluorescentemente y anticuerpos no marcados o anticuerpos de prueba a células animales que expresan NR10, y los anticuerpos marcados se detectan mediante tecnología de ensayo de microvolumen fluorométrico.

En el presente documento, el “anticuerpo que reconoce el mismo epítopo” se refiere a un anticuerpo que puede reducir la unión del anticuerpo marcado en al menos el 50% a una concentración que es habitualmente 100 veces mayor, preferiblemente 80 veces mayor, más preferiblemente 50 veces mayor, incluso más preferiblemente 30 veces mayor, y todavía más preferiblemente 10 veces mayor que una concentración a la que el anticuerpo no marcado reduce la unión del anticuerpo marcado en el 50% (CI50).

Los anticuerpos que se unen al epítopo al que se unen los anticuerpos expuestos en uno cualquiera de (1) a (7) anteriormente son útiles porque tienen una actividad de neutralización particularmente alta.

Los anticuerpos expuestos en uno cualquiera de (1) a (8) anteriormente son preferiblemente anticuerpos humanizados, pero no se limitan particularmente a los mismos.

Además, se dan a conocer genes que codifican para los anticuerpos anti-NR10 de uno cualquiera de (1) a (8) de (A) a (D) anteriormente. Los genes dados a conocer en el presente documento pueden ser cualquier forma de genes, por ejemplo, ADN o ARN.

Anticuerpos (humanizados) Las realizaciones preferidas de los anticuerpos tal como se dan a conocer en el presente documento incluyen anticuerpos humanizados que se unen a NR10. Los anticuerpos humanizados pueden prepararse mediante métodos conocidos por los expertos en la técnica.

La región variable de anticuerpo está compuesta normalmente por tres regiones determinantes de complementariedad (CDR) intercaladas entre cuatro marcos (FR). Las CDR determinan sustancialmente la especificidad de unión del anticuerpo. Las secuencias de aminoácidos de CDR son altamente diversas. En cambio, las secuencias de aminoácidos de FR a menudo presentan alta homología entre anticuerpos que tienen diferentes especificidades de unión. Se dice por tanto en general que la especificidad de unión de un anticuerpo puede trasplantarse a un anticuerpo diferente mediante injerto de las CDR.

Los anticuerpos humanizados también se denominan anticuerpos humanos reconformados y se preparan transfiriendo las CDR de un anticuerpo derivado de un mamífero no humano tal como un ratón, a las CDR de un anticuerpo humano. También se conocen técnicas de recombinación genética generales para su preparación (véase la publicación de solicitud de patente europea n.º 125023 y el documento WO 96/02576).

Específicamente, por ejemplo, cuando las CDR se derivan de un anticuerpo de ratón, se sintetiza mediante PCR una secuencia de ADN diseñada de manera que las CDR del anticuerpo de ratón se unan con las regiones de marco (FR) de anticuerpo humano usando, como cebadores, varios oligonucleótidos que tienen porciones que solapan los extremos de tanto CDR como FR (véase el método descrito en el documento WO 98/13388). El ADN resultante se liga entonces a un ADN que codifica para una región constante de anticuerpo humano, se inserta en un vector de expresión y se introduce en un huésped para producir el anticuerpo (véase la publicación de solicitud de patente europea n.º EP 239400 y la publicación de solicitud de patente internacional n.º WO 96/02576).

Se seleccionan regiones de marco de anticuerpo humano que van a unirse con CDR de modo que las CDR formen un sitio de unión a antígeno favorable. Si es necesario, puede introducirse sustitución, deleción, adición y/o inserción de aminoácidos en las regiones de marco de la región variable de anticuerpo de modo que las CDR del anticuerpo humano reconformado formen un sitio de unión a antígeno apropiado. Por ejemplo, pueden introducirse mutaciones en la secuencia de aminoácidos de FR aplicando el método de PCR que se usa para injertar CDR de ratón en FR humanas. Específicamente, pueden introducirse mutaciones en una porción de las secuencias de nucleótidos de cebadores que se aparean con las FR. Las mutaciones se introducen en FR sintetizadas por tales cebadores. La actividad de unión a antígeno de anticuerpos mutantes que tienen sustituciones de aminoácidos puede determinarse y evaluarse mediante el método descrito anteriormente, y de ese modo pueden seleccionarse secuencias de FR mutantes que tienen propiedades deseadas (Sato, K. et al., Cancer Res. (1993) 53, 851-856).

Se usan regiones constantes (C) de anticuerpos humanos para las de anticuerpos humanizados. Por ejemplo, se usan C1, C2, C3, C4, C, C, C1, C2 y C para las cadenas H; y se usan C y C para las cadenas L. La secuencia de aminoácidos de C se muestra en SEQ ID NO: 58, y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 57. La secuencia de aminoácidos de C1 se muestra en SEQ ID NO: 60, y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 59. La secuencia de aminoácidos de C2 se muestra en SEQ ID NO: 62, y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 61. La secuencia de aminoácidos de C4 se muestra en SEQ ID NO: 64, y la secuencia de nucleótidos que codifica para esta secuencia de aminoácidos se muestra en SEQ ID NO: 63. Además, pueden modificarse regiones C de anticuerpos humanos para mejorar la estabilidad de anticuerpos o la producción de anticuerpos. Las regiones C de anticuerpos humanos modificadas incluyen, por ejemplo, las regiones C descritas a continuación en el presente documento. Los anticuerpos humanos usados para la humanización pueden ser de cualquier isotipo tal como IgG, IgM, IgA, IgE o IgD; sin embargo, se usa preferiblemente IgG en la presente invención. IgG que puede usarse incluye IgG1, IgG2, IgG3, IgG4, y similares.

Además, tras prepararse un anticuerpo humanizado, los aminoácidos en la región variable (por ejemplo, CDR y FR) y la región constante del anticuerpo humanizado pueden delecionarse, añadirse, insertarse y/o sustituirse por otros aminoácidos. Los anticuerpos tal como se dan a conocer en el presente documento también incluyen tales anticuerpos humanizados con sustituciones de aminoácidos y similares.

El origen de CDR de un anticuerpo humanizado no está particularmente limitado, y puede ser cualquier animal. Por ejemplo, es posible usar las secuencias de anticuerpos de ratón, anticuerpos de rata, anticuerpos de conejo, anticuerpos de camello, y similares. Se prefieren secuencias de CDR de anticuerpos de ratón.

En general, es difícil humanizar anticuerpos reteniendo al mismo tiempo las actividades de neutralización y unión de los anticuerpos originales. La presente invención, sin embargo, tuvo éxito en obtener anticuerpos humanizados que tienen las actividades de neutralización y/o unión equivalentes a las de los anticuerpos de ratón originales. Los anticuerpos humanizados son útiles cuando se administran a seres humanos para los fines terapéuticos, debido a que presentan inmunogenicidad reducida en el cuerpo humano.

Los ejemplos preferidos de los anticuerpos humanizados anti-NR10 tal como se da a conocer en el presente documento incluyen, por ejemplo: (a) anticuerpos humanizados que comprenden una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 (H0-VH); (b) anticuerpos humanizados que comprenden una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 112 (H1-VH); (c) anticuerpos humanizados que comprenden una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52 (L0-VL); (d) anticuerpos humanizados que comprenden una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 (H0-VH) y una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52 (L0-VL); y (e) anticuerpos humanizados que comprenden una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 112 y una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

La región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 (H0-VH), la región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 112 y la región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52 (L0-VL) pueden tener una sustitución, deleción, adición y/o inserción de uno o más aminoácidos. La sustitución, deleción, adición y/o inserción de aminoácidos puede hacerse en cualquiera o ambas de las CDR y FR.

Por tanto, otras realizaciones preferidas del anticuerpo humanizado anti-NR10 tal como se da a conocer en el presente documento incluyen, por ejemplo: (f) anticuerpos que comprenden una región variable de cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 50 (H0-VH); (g) anticuerpos que comprenden una región variable de cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 112 (H1-VH); (h) anticuerpos que comprenden una región variable de cadena ligera que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 52 (L0-VL); (i) anticuerpos que comprenden una región variable de cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 50 (H0-VH), y una región variable de cadena ligera que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 52 (L0-VL); (j) anticuerpos que comprenden una región variable de cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 112 (H1- VH), y una región variable de cadena ligera que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 52 (L0-VL).

Sin particular limitación, los anticuerpos de uno cualquiera de (f) a (j) tienen preferiblemente una actividad similar a la de los anticuerpos de uno cualquiera de (a) a (e).

La sustitución, deleción, adición y/o inserción de aminoácidos no están particularmente limitadas, pero los ejemplos específicos incluyen, por ejemplo, las sustituciones de aminoácidos descritas anteriormente.

Más específicamente, por ejemplo, pueden incluirse las siguientes sustituciones de aminoácidos: Sustitución de Ile en la posición 3 de CDR1 (SEQ ID NO: 9) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Val (SEQ ID NO: 173). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 9 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 173 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Met en la posición 4 de CDR1 (SEQ ID NO: 9) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Ile (SEQ ID NO: 174). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 9 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 174 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Met en la posición 4 de CDR1 (SEQ ID NO: 9) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Leu (SEQ ID NO: 175). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 9 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 175 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Ile en la posición 3 de CDR1 (SEQ ID NO: 9) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Ala (SEQ ID NO: 176). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 9 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 176 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Leu en la posición 1 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Glu (SEQ ID NO: 113). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 113 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Asn en la posición 3 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Asp (SEQ ID NO: 114). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 114 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Gln en la posición 13 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Asp (SEQ ID NO: 115). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 115 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Lys en la posición 14 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Gln (SEQ ID NO: 116). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 116 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Lys en la posición 16 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Gln (SEQ ID NO: 117). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 117 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Gly en la posición 17 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Asp (SEQ ID NO: 118). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 118 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Lys en la posición 16 y Gly en la posición 17 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Gln y Asp, respectivamente (SEQ ID NO: 119). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 119 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Lys en la posición 14, Lys en la posición 16 y Gly en la posición 17 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Gln, Gln y Asp, respectivamente (SEQ ID NO: 167). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 171 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Gln en la posición 13, Lys en la posición 14, Lys en la posición 16 y Gly en la posición 17 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Asp, Gln, Gln y Asp, respectivamente (SEQ ID NO: 172). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 172 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Ser en la posición 10 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Asp (SEQ ID NO: 177). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 177 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Gln en la posición 13 de CDR2 (SEQ ID NO: 10) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Pro (SEQ ID NO: 178). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 10 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 178 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Tyr en la posición 3 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Leu (SEQ ID NO: 179). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 179 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Met en la posición 10 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Leu (SEQ ID NO: 180). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 180 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Asp en la posición 11 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Glu (SEQ ID NO: 181). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 181 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Tyr en la posición 12 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Thr (SEQ ID NO: 182). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 182 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Tyr en la posición 12 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Ser (SEQ ID NO: 183). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 183 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Met en la posición 10, Asp en la posición 11 y Tyr en la posición 12 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Leu, Glu, Thr, respectivamente (SEQ ID NO: 184).

Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 184 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Asp en la posición 11 y Tyr en la posición 12 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Glu y Thr, respectivamente (SEQ ID NO: 185). Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 185 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Tyr en la posición 3, Asp en la posición 11 y Tyr en la posición 12 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Leu, Glu y Thr, respectivamente (SEQ ID NO: 186).

Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 186 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Tyr en la posición 3, Asp en la posición 11 y Tyr en la posición 12 de CDR3 (SEQ ID NO: 11) en la región variable de cadena pesada de SEQ ID NO: 50 ó 112 por Leu, Glu y Ser, respectivamente (SEQ ID NO: 187).

Por tanto, se dan a conocer regiones variables de cadena pesada en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 11 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 187 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Sustitución de Arg en la posición 1 de CDR1 (SEQ ID NO: 13) en la región variable de cadena ligera de SEQ ID NO: 52 por Gln (SEQ ID NO: 121). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 121 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Asn en la posición 5 de CDR1 (SEQ ID NO: 13) en la región variable de cadena ligera de SEQ ID NO: 52 por Asp (SEQ ID NO: 122). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 122 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Ser en la posición 8 de CDR1 (SEQ ID NO: 13) en la región variable de cadena ligera de SEQ ID NO: 52 por Arg (SEQ ID NO: 188). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 188 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Leu en la posición 10 de CDR1 (SEQ ID NO: 13) de la región variable de cadena ligera de SEQ ID NO: 52 por Val (SEQ ID NO: 189). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 189 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Ser en la posición 8 y Leu en la posición 10 de CDR1 (SEQ ID NO: 13) de la región variable de cadena ligera de SEQ ID NO: 52 por Arg y Val, respectivamente (SEQ ID NO: 190). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 190 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Thr en la posición 2 de CDR1 (SEQ ID NO: 13) en la región variable de cadena ligera de SEQ ID NO: 52 por Ala (SEQ ID NO: 191). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 191 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Thr en la posición 2 de CDR1 (SEQ ID NO: 13) en la región variable de cadena ligera de SEQ ID NO: 52 por Ser (SEQ ID NO: 192). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 192 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Asn en la posición 1 de CDR2 (SEQ ID NO: 14) en la región variable de cadena ligera de SEQ ID NO: 52 por Asp (SEQ ID NO: 123). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 14 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 123 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Lys en la posición 3 de CDR2 (SEQ ID NO: 14) en la región variable de cadena ligera de SEQ ID NO: 52 por Gln (SEQ ID NO: 124). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 14 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 124 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Leu en la posición 5 de CDR2 (SEQ ID NO: 14) en la región variable de cadena ligera de SEQ ID NO: 52 por Glu (SEQ ID NO: 125). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 14 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 125 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Lys en la posición 7 de CDR2 (SEQ ID NO: 14) en la región variable de cadena ligera de SEQ ID NO: 52 por Gln (SEQ ID NO: 126). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 14 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 126 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Lys en la posición 7 de CDR2 (SEQ ID NO: 14) en la región variable de cadena ligera de SEQ ID NO: 52 por Asp (SEQ ID NO: 127). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 14 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 127 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Arg en la posición 1 y Asn en la posición 5 de CDR1 (SEQ ID NO: 13) en la región variable de cadena ligera de SEQ ID NO: 52 por Gln y Asp, respectivamente (SEQ ID NO: 169). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 13 se sustituye por CDR1 que tiene la secuencia de aminoácidos de SEQ ID NO: 169 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Lys en la posición 3, Leu en la posición 5 y Lys en la posición 7 de CDR2 (SEQ ID NO: 14) en la región variable de cadena ligera de SEQ ID NO: 52 por Gln, Glu y Gln, respectivamente (SEQ ID NO: 170). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 14 se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 170 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Glu en la posición 5 de CDR3 (SEQ ID NO: 15) en la región variable de cadena ligera de SEQ ID NO: 52 por Asp (SEQ ID NO: 193). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 15 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 193 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Ser en la posición 6 de CDR3 (SEQ ID NO: 15) en la región variable de cadena ligera de SEQ ID NO: 52 por Asp (SEQ ID NO: 194). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 15 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 194 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Sustitución de Thr en la posición 9 de CDR3 (SEQ ID NO: 15) en la región variable de cadena ligera de SEQ ID NO: 52 por Phe (SEQ ID NO: 195). Por tanto, se dan a conocer regiones variables de cadena ligera en las que CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 15 se sustituye por CDR3 que tiene la secuencia de aminoácidos de SEQ ID NO: 195 en una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 52.

Además, las sustituciones distintas de las descritas anteriormente incluyen una sustitución de Arg en la posición 3 de FR2 de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 97 por otro aminoácido. El aminoácido después de la sustitución no está particularmente limitado; pero ejemplos preferidos del mismo incluyen Gln. Cuando Arg en la posición 3 en SEQ ID NO: 97 se ha reemplazado por Gln, Ala en la posición 5 puede sustituirse por Ser para producir una secuencia FR2 humana. La secuencia de aminoácidos en la que Arg y Ala en las posiciones 3 y 5 en la secuencia de aminoácidos de SEQ ID NO: 97 se han reemplazado por Gln y Ser, respectivamente, se muestra en SEQ ID NO: 120. Por tanto, la presente invención proporciona regiones variables de cadena pesada en las que FR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 97 se sustituye por FR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 120 en una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 50 ó 112.

Cada una de las sustituciones de aminoácidos descritas anteriormente puede usarse sola o en combinación con otras sustituciones de aminoácidos descritas anteriormente. También pueden combinarse con sustituciones de aminoácidos distintas de las descritas anteriormente.

Los ejemplos específicos de los anticuerpos en los que se han llevado a cabo las sustituciones descritas anteriormente incluyen, por ejemplo, anticuerpos que comprenden una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 167, anticuerpos que comprenden una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 168, y anticuerpos que comprenden una región variable de cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 167 y una región variable de cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 168.

Además, los ejemplos específicos de las regiones variables de cadena pesada en las que se han llevado a cabo las sustituciones descritas anteriormente incluyen, por ejemplo, las siguientes regiones variables de cadena pesada: (1) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 204 (H17); (2) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 205 (H19); (3) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 206 (H28); (4) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 207 (H30); (5) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 208 (H34); (6) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 209 (H42); (7) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 210 (H44); (8) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 211 (H46); (9) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 212 (H57); (10) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 213 (H71); (11) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 214 (H78); (12) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 215 (H92); (13) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 216 (H97); y (14) regiones variables de cadena pesada que tienen la secuencia de aminoácidos de SEQ ID NO: 217 (H98).

Mientras tanto, los ejemplos específicos de las regiones variables de cadena ligera en las que se han llevado a cabo las sustituciones descritas anteriormente incluyen, por ejemplo, las siguientes regiones variables de cadena ligera: (15) regiones variables de cadena ligera que tienen la secuencia de aminoácidos de SEQ ID NO: 218 (L11); (16) regiones variables de cadena ligera que tienen la secuencia de aminoácidos de SEQ ID NO: 219 (L12); (17) regiones variables de cadena ligera que tienen la secuencia de aminoácidos de SEQ ID NO: 220 (L17); y (18) regiones variables de cadena ligera que tienen la secuencia de aminoácidos de SEQ ID NO: 221 (L50).

Además, los ejemplos específicos de los anticuerpos que comprenden las regiones variables de cadena pesada y cadena ligera descritas anteriormente incluyen, por ejemplo, los siguientes anticuerpos: (19) anticuerpos que comprenden la región variable de cadena pesada de (3) y la región variable de cadena ligera de (17) (H28L17); (20) anticuerpos que comprenden la región variable de cadena pesada de (4) y la región variable de cadena ligera de (17) (H30L17); (21) anticuerpos que comprenden la región variable de cadena pesada de (5) y la región variable de cadena ligera de (17) (H34L17); (22) anticuerpos que comprenden la región variable de cadena pesada de (6) y la región variable de cadena ligera de (17) (H42L17); (23) anticuerpos que comprenden la región variable de cadena pesada de (7) y la región variable de cadena ligera de (17) (H44L17); (24) anticuerpos que comprenden la región variable de cadena pesada de (8) y la región variable de cadena ligera de (17) (H46L17); (25) anticuerpos que comprenden la región variable de cadena pesada de (9) y la región variable de cadena ligera de (17) (H57L17); (26) anticuerpos que comprenden la región variable de cadena pesada de (10) y la región variable de cadena ligera de (17) (H71L17), (27) anticuerpos que comprenden la región variable de cadena pesada de (11) y la región variable de cadena ligera de (17) (H78L17); (28) anticuerpos que comprenden la región variable de cadena pesada de (12) y la región variable de cadena ligera de (17) (H92L17); (29) anticuerpos que comprenden la región variable de cadena pesada de (13) y la región variable de cadena ligera de (18) (H97L50); y (30) anticuerpos que comprenden la región variable de cadena pesada de (14) y la región variable de cadena ligera de (18) (H98L50).

La región constante usada para los anticuerpos humanizados tal como se da a conocer en el presente documento puede ser cualquier región constante derivada de un anticuerpo humano. Los ejemplos preferidos de tales regiones constantes derivadas de anticuerpos humanos incluyen, por ejemplo, regiones constantes derivadas de IgG1 o IgG2. Además, también pueden usarse regiones constantes en las que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la región constante derivada de un anticuerpo humano.

Las regiones constantes en las que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la región constante derivada de un anticuerpo humano no están particularmente limitadas, e incluyen, por ejemplo, las siguientes regiones constantes: regiones constantes que tienen la secuencia de aminoácidos de SEQ ID NO: 128 (M58); regiones constantes que tienen la secuencia de aminoácidos de SEQ ID NO: 129 (M14); y regiones constantes que tienen la secuencia de aminoácidos de SEQ ID NO: 62 (SKSC).

Los ejemplos específicos de las cadenas pesadas o anticuerpos que tienen las regiones constantes descritas anteriormente incluyen, por ejemplo: (1) cadenas pesadas que comprenden una región variable que tiene la secuencia de aminoácidos de SEQ ID NO: 167 y una región constante que tiene la secuencia de aminoácidos de SEQ ID NO: 128; (2) cadenas pesadas en las que CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 171 en las cadenas pesadas de (1) se sustituye por CDR2 que tiene la secuencia de aminoácidos de SEQ ID NO: 172; (3) anticuerpos que comprenden la cadena pesada de (1) y una cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 152; y (4) anticuerpos que comprenden la cadena pesada de (2) y una cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 152.

Más ejemplos específicos de los anticuerpos humanizados anti-NR10 tal como se dan a conocer en el presente documento incluyen, por ejemplo, los siguientes anticuerpos: (k) anticuerpos que comprenden una cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 54 (H0- VH + región constante); (l) anticuerpos que comprenden una cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 130 (H1-VH + región constante); (m) anticuerpos que comprenden una cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 56 (L0- VL + región constante); (n) anticuerpos que comprenden una cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 54 (H0- VH + región constante) y una cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 56 (L0-VL + región constante); y (o) anticuerpos que comprenden una cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 130 (H1-VH + región constante) y una cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 56 (L0-VL + región constante).

La cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 54 (H0-VH + región constante) y la cadena ligera que tiene la secuencia de aminoácidos de SEQ ID NO: 56 (L0-VL + región constante) pueden tener una sustitución, deleción, adición y/o inserción de uno o más aminoácidos. La sustitución, deleción, adición y/o inserción de aminoácidos puede llevarse a cabo en cualquiera o ambas de las regiones variables y constantes.

Por tanto, se dan a conocer: (p) anticuerpos que comprenden una cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 54 (H0- VH + región constante); (q) anticuerpos que comprenden una cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 130 (H1-VH + región constante); (r) anticuerpos que comprenden una cadena ligera que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 56 (L0- VL + región constante); (s) anticuerpos que comprenden una cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 54 (H0- VH + región constante) y una cadena ligera que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 56 (L0- VL + región constante); y (t) anticuerpos que comprenden una cadena pesada que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 130 (H1-VH + región constante) y una cadena ligera que tiene una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en la secuencia de aminoácidos de SEQ ID NO: 56 (L0- VL + región constante).

Sin limitación particular, los anticuerpos de uno cualquiera de (p) a (t) tienen preferiblemente una actividad similar a la de los anticuerpos de uno cualquiera de (k) a (o).

La sustitución, deleción, adición y/o inserción de aminoácidos no están particularmente limitadas, pero los ejemplos específicos de las mismas incluyen, por ejemplo, las sustituciones de aminoácidos descritas anteriormente.

Además, la secuencia de nucleótidos que codifica para la secuencia de aminoácidos de región variable de cadena pesada humanizada descrita anteriormente (SEQ ID NO: 50) se muestra en SEQ ID NO: 49. La secuencia de nucleótidos que codifica para la secuencia de aminoácidos de la región variable de cadena ligera humanizada (SEQ ID NO: 52) se muestra en SEQ ID NO: 51. La secuencia de nucleótidos que codifica para la secuencia de aminoácidos de la cadena pesada humanizada (SEQ ID NO: 54) se muestra en SEQ ID NO: 53. La secuencia de nucleótidos que codifica para la secuencia de aminoácidos de la cadena ligera humanizada (SEQ ID NO: 56) se muestra en SEQ ID NO: 55.

Además, se dan a conocer anticuerpos que reconocen el mismo epítopo reconocido por los anticuerpos de uno cualquiera de (a) a (t) anteriormente. La unión al mismo epítopo ya se describió anteriormente.

Además, se dan a conocer los siguientes anticuerpos: (u) anticuerpos que comprenden una cadena pesada que tiene la secuencia de aminoácidos de SEQ ID NO: 151; (v) anticuerpos que comprenden una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 152; y (w) anticuerpos que comprenden la cadena pesada de (u) y la cadena ligera de (v).

Además, la presente invención proporciona las siguientes cadenas pesadas y ligeras y anticuerpos: (1) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 222 (H17); (2) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 223 (H19); (3) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 224 (H28); (4) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 225 (H30); (5) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 226 (H34); (6) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 227 (H42); (7) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 228 (H44); (8) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 229 (H46); (9) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 230 (H57); (10) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 231 (H71); (11) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 232 (H78); (12) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 233 (H92); (13) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 234 (H97); (14) cadenas pesadas que tienen la secuencia de aminoácidos de SEQ ID NO: 235 (H98); (15) cadenas ligeras que tienen la secuencia de aminoácidos de SEQ ID NO: 236 (L11); (16) cadenas ligeras que tienen la secuencia de aminoácidos de SEQ ID NO: 237 (L12); (17) cadenas ligeras que tienen la secuencia de aminoácidos de SEQ ID NO: 238 (L17); (18) cadenas ligeras que tienen la secuencia de aminoácidos de SEQ ID NO: 239 (L50); (19) anticuerpos que comprenden la cadena pesada de (3) y la cadena ligera de (17) (H28L17); (20) anticuerpos que comprenden la cadena pesada de (4) y la cadena ligera de (17) (H30L17); (21) anticuerpos que comprenden la cadena pesada de (5) y la cadena ligera de (17) (H34L17); (22) anticuerpos que comprenden la cadena pesada de (6) y la cadena ligera de (17) (H42L17); (23) anticuerpos que comprenden la cadena pesada de (7) y la cadena ligera de (17) (H44L17); (24) anticuerpos que comprenden la cadena pesada de (8) y la cadena ligera de (17) (H46L17); (25) anticuerpos que comprenden la cadena pesada de (9) y la cadena ligera de (17) (H57L 17); (26) anticuerpos que comprenden la cadena pesada de (10) y la cadena ligera de (17) (H71L17); (27) anticuerpos que comprenden la cadena pesada de (11) y la cadena ligera de (17) (H78L17); (28) anticuerpos que comprenden la cadena pesada de (12) y la cadena ligera de (17) (H92L 17); (29) anticuerpos que comprenden la cadena pesada de (13) y la cadena ligera de (18) (H97L50); (30) anticuerpos que comprenden la cadena pesada de (14) y la cadena ligera de (18) (H98L50); (31) cadenas pesadas que tienen una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en las cadenas pesadas de uno cualquiera de (1) a (14); (32) cadenas ligeras que tienen una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en las cadenas ligeras de uno cualquiera de (15) a (18); (33) anticuerpos que tienen una secuencia de aminoácidos en la que uno o más aminoácidos se sustituyen, delecionan, añaden y/o insertan en los anticuerpos de uno cualquiera de (19) a (30); y (34) anticuerpos que reconocen el mismo epítopo reconocido por los anticuerpos de uno cualquiera de (19) a (33).

La sustitución, deleción, adición y/o inserción de aminoácidos son tal como se describió anteriormente. También se describieron anteriormente anticuerpos que reconocen el mismo epítopo reconocido por un anticuerpo.

También se dan a conocer genes que codifican para las regiones variables, cadenas pesadas, cadenas ligeras o anticuerpos de la presente invención.

También se dan a conocer vectores que portan los genes descritos anteriormente.

También se dan a conocer células huésped transformadas con los vectores descritos anteriormente.

También se dan a conocer métodos para producir regiones variables, cadenas pesadas, cadenas ligeras o anticuerpos de la presente invención, que comprenden la etapa de cultivar las células huésped descritas anteriormente.

Los vectores, las células huésped y el cultivo de células huésped se describen a continuación en el presente documento.

Anticuerpos que reconocen dominios Las realizaciones preferidas del anticuerpo anti-NR10 tal como se da a conocer en el presente documento incluyen anticuerpos que reconocen el dominio 1 o dominio 2. En la presente invención, dominio 1 se refiere a la región de aminoácidos en las posiciones 21 a 120 (LPAKP a LENIA) en la secuencia de aminoácidos de NR10 humano de SEQ ID NO: 76, donde la numeración de aminoácidos se basa en la secuencia que incluye el péptido señal. Además, tal como se da a conocer en el presente documento, dominio 2 se refiere a la región de aminoácidos en las posiciones 121 a 227 (KTEPP a EEEAP) en la secuencia de aminoácidos de NR10 humano de SEQ ID NO: 76, donde la numeración de aminoácidos se basa en la secuencia que incluye el péptido señal.

Tales anticuerpos no están limitados particularmente; sin embargo, en general, tienen una actividad de neutralización, y preferiblemente son anticuerpos humanizados.

Los ejemplos de los anticuerpos preferidos tal como se dan a conocer en el presente documento incluyen anticuerpos que reconocen el dominio 1. Los anticuerpos que reconocen el dominio 1 tienen una fuerte actividad de neutralización, y por tanto son particularmente útiles como productos farmacéuticos.

Anticuerpos (actividad de neutralización) También se dan a conocer anticuerpos anti-NR10 que tienen una actividad de neutralización.

Tal como se da a conocer en el presente documento, la actividad de neutralización contra NR10 se refiere a una actividad de inhibición de la unión entre NR10 y su ligando IL-31, y preferiblemente una actividad de supresión de una actividad biológica basada en NR10.

Pueden seleccionarse anticuerpos que tienen una actividad de neutralización de NR10, por ejemplo, añadiendo anticuerpos candidatos a una línea celular dependiente de IL-31 y observando su efecto de supresión del crecimiento sobre la línea celular. En este método, se determinan anticuerpos que suprimen el crecimiento de la línea celular dependiente de IL-31 como anticuerpos que tienen una actividad de neutralización contra NR10.

Anticuerpos (general) Los anticuerpos tal como se dan a conocer en el presente documento no están limitados en cuanto a su origen, y pueden derivarse de animales tales como seres humanos, ratones y ratas. Además, los anticuerpos pueden ser anticuerpos recombinantes tales como anticuerpos quiméricos y anticuerpos humanizados. Tal como se describió anteriormente, los anticuerpos preferidos tal como se dan a conocer en el presente documento incluyen anticuerpos humanizados.

Los anticuerpos quiméricos contienen, por ejemplo, las regiones constantes de cadena pesada y ligera de un anticuerpo humano, y las regiones variables de cadena pesada y ligera de un anticuerpo de un mamífero no humano, tal como ratón. Los anticuerpos quiméricos pueden producirse mediante métodos conocidos. Por ejemplo, los anticuerpos pueden producirse clonando un gen de anticuerpo a partir de hibridomas, insertándolo en un vector apropiado e introduciendo el constructo en huéspedes (véase, por ejemplo, Carl, A. K. Borrebaeck, James, W. Larrick, THERAPEUTIC MONOCLONAL ANTIBODIES, publicado en el Reino Unido por MACMILLAN PUBLISHERS LTD, 1990). Específicamente, se sintetizan ADNc de las regiones variables (regiones V) de anticuerpo a partir de ARNm de hibridomas usando transcriptasa inversa. Una vez que se obtienen los ADN que codifican para las regiones V de un anticuerpo de interés, se unen con ADN que codifican para las regiones constantes (regiones C) de un anticuerpo humano deseado. Los constructos resultantes se insertan en vectores de expresión. Alternativamente, los ADN que codifican para las regiones V de anticuerpo pueden insertarse en vectores de expresión que comprenden ADN que codifican para las regiones C de un anticuerpo humano. Los ADN se insertan en vectores de expresión de modo que se expresan bajo la regulación de las regiones reguladoras de la expresión, por ejemplo, potenciadores y promotores. En la siguiente etapa, pueden transformarse células huésped con los vectores de expresión para permitir la expresión de anticuerpos quiméricos.

También se conocen métodos para obtener anticuerpos humanos. Por ejemplo, pueden obtenerse anticuerpos humanos deseados con actividad de unión a antígeno (1) sensibilizando linfocitos humanos con antígenos de interés o células que expresan antígenos de interés in vitro; y (2) fusionando los linfocitos sensibilizados con células de mieloma humanas tales como U266 (véase la publicación de solicitud de patente japonesa Kokoku n.º (JP-B) H01- 59878 (solicitud de patente japonesa examinada, aprobada publicada para oposición)). Alternativamente, el anticuerpo humano deseado también puede obtenerse inmunizando un animal transgénico que tiene un repertorio completo de genes de anticuerpo con un antígeno deseado (véanse las publicaciones de patente internacional n.os WO 93/12227, WO 92/03918, WO 94/02602, WO 94/25585, WO 96/34096 y WO 96/33735).

Además, se conocen técnicas para obtener anticuerpos humanos cribando una biblioteca de fagos con anticuerpos humanos. Por ejemplo, la región variable de un anticuerpo humano se expresa como un anticuerpo de cadena sencilla (scFv) sobre la superficie de un fago, usando un método de presentación en fago, y los fagos que se unen al antígeno pueden seleccionarse. Analizando los genes de fagos seleccionados, pueden determinarse las secuencias de ADN que codifican para las regiones variables de anticuerpos humanos que se unen al antígeno. Si se identifican las secuencias de ADN de scFv que se unen al antígeno, pueden construirse vectores de expresión apropiados que comprenden estas secuencias para obtener anticuerpos humanos. Tales métodos se conocen bien. Puede hacerse referencia a los documentos WO 92/01047, WO 92/20791, WO 93/06213, WO 93/11236, WO 93/19172, WO 95/01438, WO 95/15388, y similares.

Los anticuerpos tal como se dan a conocer en el presente documento incluyen no sólo anticuerpos divalentes representados por IgG, sino también anticuerpos monovalentes, anticuerpos multivalentes representados por IgM y anticuerpos biespecíficos que pueden unirse a diferentes antígenos, siempre que tengan una actividad de neutralización de y/o actividad de unión a NR10. Los anticuerpos multivalentes tal como se dan a conocer en el presente documento incluyen anticuerpos multivalentes en los que los sitios de unión a antígeno son todos idénticos, y anticuerpos multivalentes en los que todos o algunos de los sitios de unión a antígeno son diferentes. Los anticuerpos tal como se dan a conocer en el presente documento no se limitan a moléculas de anticuerpo de longitud completa, sino que también pueden ser anticuerpos de bajo peso molecular o productos modificados de los mismos, siempre que se unan a la proteína NR10.

Alternativamente, los anticuerpos tal como se dan a conocer en el presente documento pueden ser anticuerpos de bajo peso molecular. Tales anticuerpos de bajo peso molecular son anticuerpos que incluyen fragmentos de anticuerpo que carecen de algunas porciones de un anticuerpo completo (por ejemplo, IgG completa), y no están particularmente limitados siempre que retengan la actividad de neutralización de y/o unión a NR10. Tal como se da a conocer en el presente documento, los anticuerpos de bajo peso molecular no están particularmente limitados, siempre que contengan una porción de anticuerpos completos. Los anticuerpos de bajo peso molecular contienen preferiblemente una región variable de cadena pesada (VH) o región variable de cadena ligera (VL). Anticuerpos de bajo peso molecular particularmente preferidos contienen tanto VH como VL. Además, los ejemplos preferidos de los anticuerpos de bajo peso molecular de la presente invención incluyen anticuerpos de bajo peso molecular que contienen CDR de un anticuerpo. Las CDR contenidas en los anticuerpos de bajo peso molecular pueden incluir algunas o las seis CDR de un anticuerpo.

Los anticuerpos de bajo peso molecular tal como se dan a conocer en el presente documento tienen preferiblemente un peso molecular menor que anticuerpos completos. Sin embargo, los anticuerpos de bajo peso molecular pueden formar multímeros, por ejemplo, dímeros, trímeros o tetrámeros, y por tanto sus pesos moleculares pueden ser mayores que los de anticuerpos completos.

Los ejemplos específicos de los fragmentos de anticuerpo incluyen, por ejemplo, Fab, Fab’, F(ab’)2 y Fv. Mientras tanto, los ejemplos específicos de los anticuerpos de bajo peso molecular incluyen, por ejemplo, Fab, Fab’, F(ab’)2, Fv, scFv (Fv de cadena sencilla), diacuerpos y sc(Fv)2 ((Fv)2 de cadena sencilla). También se incluyen multímeros (por ejemplo, dímeros, trímeros, tetrámeros y polímeros) de estos anticuerpos en los anticuerpos de bajo peso molecular tal como se dan a conocer en el presente documento.

Pueden obtenerse fragmentos de anticuerpo, por ejemplo, tratando anticuerpos con enzimas para producir fragmentos de anticuerpo. Las enzimas que se sabe que generan fragmentos de anticuerpo incluyen, por ejemplo, papaína, pepsina y plasmina. Alternativamente, puede construirse un gen que codifica para un fragmento de anticuerpo de este tipo, introducirse en un vector de expresión y expresarse en células huésped apropiadas (véase, por ejemplo, Co, M.S. et al., J. Immunol. (1994)152, 2968-2976; Better, M. & Horwitz, A. H. Methods in Enzymology (1989)178, 476-496; Plueckthun, A. & Skerra, A. Methods in Enzymology (1989)178, 476-496; Lamoyi, E., Methods in Enzymology (1989)121, 652-663; Trousseaux, J. et al., Methods in Enzymology (1989)121, 663-669; Bird, R. E. et al., TIBTECH (1991)9, 132-137).

Las enzimas digestivas escinden un sitio específico de un fragmento de anticuerpo, produciendo fragmentos de anticuerpo de estructuras específicas mostradas más adelante. Pueden aplicarse técnicas de ingeniería genética a tales fragmentos de anticuerpo obtenidos enzimáticamente para delecionar una porción arbitraria del anticuerpo.

Fragmentos de anticuerpo obtenidos usando las enzimas digestivas descritas anteriormente son las siguientes: Digestión con papaína: F(ab)2 o Fab Digestión con pepsina: F(ab’)2 o Fab’ Digestión con plasmina: Facb Los anticuerpos de bajo peso molecular tal como se dan a conocer en el presente documento incluyen fragmentos de anticuerpo que carecen de una región arbitraria, siempre que tengan una actividad de neutralización de y/o actividad de unión a NR10.

“Diacuerpo” se refiere a un fragmento de anticuerpo bivalente construido mediante fusión génica (Holliger P et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993); documento EP 404,097; documento WO 93/11161, etc.). Los diacuerpos son dímeros compuestos por dos cadenas polipeptídicas. En cada una de las cadenas polipeptídicas que forman un dímero, se unen habitualmente una VL y una VH mediante un ligador en la misma cadena. En general, el ligador en un diacuerpo es suficientemente corto como para que la VL y VH no puedan unirse entre sí. Específicamente, el número de residuos de aminoácido que constituyen el ligador es, por ejemplo, de aproximadamente cinco residuos. Por tanto, la VL y VH codificadas en el mismo polipéptido no pueden formar un fragmento de región variable de cadena sencilla, y formarán un dímero con otro fragmento de región variable de cadena sencilla. Como resultado, el diacuerpo tiene dos sitios de unión a antígeno.

Los anticuerpos scFv son polipéptidos de cadena sencilla producidos uniendo una región variable de cadena pesada ([VH]) y una región variable de cadena ligera ([VL]) por medio de un ligador o similar (Huston, J. S. et al., Proc. Natl. Acad. Sci. U.S.A. (1988) 85, 5879-5883; Pluckthun “The Pharmacology of Monoclonal Antibodies” vol. 113, eds., Resenburg y Moore, Springer Verlag, Nueva York, págs. 269-315, (1994)). La región V de cadena H y la región V de cadena L de scFv pueden derivarse de cualquier anticuerpo descrito en el presente documento. El ligador polipeptídico para unir las regiones V no está particularmente limitado. Por ejemplo, puede usarse como ligador un péptido de cadena sencilla arbitrario que contiene de aproximadamente tres a 25 residuos. Específicamente, es posible usar los ligadores peptídicos o similares descritos más adelante.

Las regiones V de ambas cadenas pueden unirse, por ejemplo, mediante PCR tal como se describió anteriormente.

En primer lugar, entre los siguientes ADN, se usa un ADN que codifica para una secuencia de aminoácidos parcial deseada o completa como molde para unir las regiones V mediante PCR: secuencia de ADN que codifica para una cadena H o región V de cadena H de un anticuerpo, y secuencia de ADN que codifica para una cadena L o región V de cadena L de un anticuerpo.

Los ADN que codifican para las regiones V de cadena H y cadena L se amplifican mediante PCR usando un par de cebadores que tienen secuencias correspondientes a las de ambos extremos del ADN que va a amplificarse. Entonces, se prepara un ADN que codifica para la parte de ligador peptídico. El ADN que codifica para el ligador peptídico también puede sintetizarse mediante PCR. En este caso, se añaden secuencias de nucleótidos que pueden ligarse a los productos de amplificación de regiones V sintetizadas por separado al extremo 5’ de los cebadores que van a usarse. Entonces, se lleva a cabo PCR usando cada ADN de [ADN de región V de cadena H] [ADN de ligador peptídico] - [ADN de región V de cadena L], y cebadores de PCR de ensamblaje.

Los cebadores de PCR de ensamblaje están compuestos por una combinación de un cebador que se aparea al extremo 5’ del [ADN de región V de cadena H] y un cebador que se aparea al extremo 3’ del [ADN de región V de cadena L]. En otras palabras, los cebadores de PCR de ensamblaje son un conjunto de cebadores que pueden usarse para amplificar ADN que codifica para la secuencia de longitud completa de scFv que va a sintetizarse.

Mientras tanto, se han añadido secuencias de nucleótidos que pueden ligarse a los ADN de región V al [ADN de ligador peptídico]. Por tanto, estos ADN se unen entre sí, y entonces se genera en última instancia el scFv completo como un producto de amplificación mediante los cebadores de PCR de ensamblaje. Una vez generados los ADN que codifican para scFv, pueden obtenerse vectores de expresión que portan estos ADN y células recombinantes transformadas con estos vectores de expresión mediante métodos convencionales. Además, el scFv puede obtenerse cultivando las células recombinantes resultantes para expresar los ADN que codifican para scFv.

El orden de las regiones variables de cadena pesada y cadena ligera que van a unirse entre sí no está particularmente limitado, y pueden disponerse en cualquier orden. Se enumeran a continuación ejemplos de la disposición.

[VH] ligador [VL] [VL] ligador [VH] sc(Fv)2 es un anticuerpo de bajo peso molecular de cadena sencilla producido mediante la unión de dos VH y dos VL usando ligadores y similares (Hudson et al., J Immunol. Methods 1999; 231: 177-189). Por ejemplo, sc(Fv)2 puede producirse mediante la unión de scFv por medio de un ligador.

Se prefieren anticuerpos en los que dos VH y dos VL se disponen en el orden de VH-VL-VH-VL ([VH] ligador [VL] ligador [VH] ligador [VL]) a partir del extremo N-terminal del polipéptido de cadena sencilla. Sin embargo, el orden de las dos VH y dos VL no se limita a la disposición anterior, y pueden disponerse en cualquier orden. Se enumeran ejemplos de la disposición a continuación: [VL] ligador [VH] ligador [VH] ligador [VL] [VH] ligador [VL] ligador [VL] ligador [VH] [VH] ligador [VH] ligador [VL] ligador [VL] [VL] ligador [VL] ligador [VH] ligador [VH] [VL] ligador [VH] ligador [VL] ligador [VH] La secuencia de aminoácidos de la región variable de cadena pesada o región variable de cadena ligera en un anticuerpo de bajo peso molecular puede contener una sustitución, deleción, adición y/o inserción. Además, la región variable de cadena pesada y región variable de cadena ligera también pueden carecer de algunas porciones o tener adiciones de otros polipéptidos, siempre que tengan una capacidad de unión a antígeno cuando se unen entre sí. Alternativamente, las regiones variables pueden quimerizarse o humanizarse.

En la presente invención, los ligadores que se unen a las regiones variables del anticuerpo incluyen ligadores peptídicos arbitrarios que pueden introducirse usando ingeniería genética, o ligadores sintéticos tales como los dados a conocer en Protein Engineering, 9(3), 299-305, 1996.

Los ligadores preferidos tal como se dan a conocer en el presente documento son ligadores peptídicos. Las longitudes de los ligadores peptídicos no están particularmente limitadas y los expertos en la técnica pueden seleccionar apropiadamente las longitudes dependiendo del fin. Longitudes típicas son una de 100 aminoácidos, preferiblemente de 3 a 50 aminoácidos, más preferiblemente de 5 a 30 aminoácidos, y de manera particularmente preferible de 12 a 18 aminoácidos (por ejemplo, 15 aminoácidos).

Las secuencias de aminoácidos de tales ligadores peptídicos incluyen, por ejemplo: Ser; Gly-Ser; Gly-Gly-Ser; Ser-Gly-Gly; Gly-Gly-Gly-Ser (SEQ ID NO: 82); Ser-Gly-Gly-Gly (SEQ ID NO: 83); Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 84); Ser-Gly-Gly-Gly-Gly (SEQ ID NO: 85); Gly-Gly-Gly-Gly-Gly-Set (SEQ ID NO: 86); Ser-Gly-Gly-Gly-Gly-Gly (SEQ ID NO: 87); Gly-Gly-Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 88); Ser-Gly-Gly-Gly-Gly-Gly-Gly (SEQ ID NO: 89); (Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 84))n; y (Ser-Gly-Gly-Gly-Gly (SEQ ID NO: 85))n, en las que n es un número entero de 1 o mayor.

La secuencia de aminoácidos del ligador peptídico puede seleccionarse apropiadamente por los expertos en la técnica dependiendo del fin. Por ejemplo, la “n” mencionada anteriormente, que determina la longitud del ligador peptídico, es habitualmente de 1 a 5, preferiblemente de 1 a 3 y más preferiblemente 1 ó 2.

Los ligadores sintéticos (agentes de reticulación químicos) incluyen agentes de reticulación que se usan de manera rutinaria para reticular péptidos, por ejemplo, N-hidroxisuccinimida (NHS), suberato de disuccinimidilo (DSS), suberato de bis(sulfosuccinimidilo) (BS3), ditiobis(propionato de succinimidilo) (DSP), ditiobis(propionato de sulfosuccinimidilo) (DTSSP), etilenglicol-bis(succinato de succinimidilo) (EGS), etilenglicol-bis(succinato de sulfosuccinimidilo) (sulfo-EGS), tartrato de disuccinimidilo (DST), tartrato de disulfosuccinimidilo (sulfo-DST), bis[2- (succinimidoxicarboniloxi)etil]sulfona (BSOCOES) y bis[2-(sulfosuccinimidoxicarboniloxi)etil]sulfona (sulfo- BSOCOES). Estos agentes de reticulación están disponibles comercialmente.

Cuando se unen cuatro regiones variables de anticuerpo, se requieren habitualmente tres ligadores. Tales ligadores múltiples pueden ser iguales o diferentes.

Los anticuerpos tal como se dan a conocer en el presente documento incluyen anticuerpos en los que uno o más residuos de aminoácido se han añadido a la secuencia de aminoácidos de un anticuerpo de la presente invención.

Además, se incluyen en la presente invención proteínas de fusión que resultan de una fusión entre uno de los anticuerpos anteriores y un segundo péptido o proteína. Las proteínas de fusión pueden prepararse ligando un polinucleótido que codifica para un anticuerpo tal como se da a conocer en el presente documento y un polinucleótido que codifica para un segundo péptido o polipéptido en marco, insertando esto en un vector de expresión, y expresando el constructo de fusión en un huésped. Algunas técnicas conocidas por los expertos en la técnica están disponibles para este fin. El péptido o polipéptido compañero que va a fusionarse con un anticuerpo de la presente invención puede ser un péptido conocido, por ejemplo, FLAG (Hopp, T. P. et al., BioTechnology 6, 1204- 1210 (1988)), 6x His que consiste en seis residuos de His (histidina), 10x His, hemaglutinina de influenza (HA), fragmento c-myc humano, fragmento GP de VSV, fragmento p18HIV, etiqueta de T7, etiqueta de VHS, etiqueta E, fragmento de antígeno T de SV40, etiqueta lck, fragmento de -tubulina, etiqueta B, fragmento de proteína C. Otros polipéptidos compañeros que van a fusionarse con los anticuerpos de la presente invención incluyen, por ejemplo, GST (glutatión-S-transferasa), HA (hemaglutinina de influenza), región constante de inmunoglobulina, - galactosidasa y MBP (proteína de unión a maltosa). Puede fusionarse un polinucleótido que codifica para uno de estos péptidos o polipéptidos disponibles comercialmente con un polinucleótido que codifica para un anticuerpo tal como se da a conocer en el presente documento. El polipéptido de fusión puede prepararse expresando el constructo de fusión.

Además, los anticuerpos tal como se dan a conocer en el presente documento pueden ser anticuerpos conjugados que se unen a cualquiera de diversas moléculas incluyendo sustancias poliméricas tales como polietilenglicol (PEG) y ácido hialurónico, sustancias radiactivas, sustancias fluorescentes, sustancias luminiscentes, enzimas y toxinas. Tales anticuerpos conjugados pueden obtenerse modificando químicamente los anticuerpos obtenidos. Se han establecido en este campo métodos para modificar anticuerpos (por ejemplo, documentos US 5057313 y US 5156840). Los “anticuerpos” de la presente invención también incluyen tales anticuerpos conjugados.

Además, los anticuerpos usados en la presente divulgación pueden ser anticuerpos biespecíficos. El anticuerpo biespecífico se refiere a un anticuerpo que tiene regiones variables que reconocen diferentes epítopos en la misma molécula de anticuerpo. Tal como se da a conocer en el presente documento, los anticuerpos biespecíficos pueden reconocer diferentes epítopos en una molécula de NR10, o reconocer NR10 con un sitio de unión a antígeno y una sustancia diferente con el otro sitio de unión a antígeno.

Se conocen métodos para producir anticuerpos biespecíficos. Pueden prepararse anticuerpos biespecíficos, por ejemplo, uniendo dos anticuerpos que reconocen diferentes antígenos. Los anticuerpos que van a unirse entre sí pueden ser la mitad de una molécula cada una de las cuales contiene una cadena H y una cadena L, o un cuarto de una molécula que consiste sólo en una cadena H. Alternativamente, pueden fusionarse hibridomas que producen diferentes anticuerpos monoclonales para producir una célula fusionada que produce anticuerpos biespecíficos. Además, pueden producirse anticuerpos biespecíficos mediante técnicas de ingeniería genética.

Los anticuerpos tal como se dan a conocer en el presente documento pueden diferir en la secuencia de aminoácidos, el peso molecular, el punto isoeléctrico, la presencia/ausencia de cadenas de azúcar y la conformación dependiendo de la célula o el huésped que produce el anticuerpo o el método de purificación tal como se describe a continuación. Sin embargo, se incluye un anticuerpo resultante en la presente divulgación, siempre que sea funcionalmente equivalente a un anticuerpo de la presente invención. Por ejemplo, cuando un anticuerpo de la presente invención se expresa en células procariotas, por ejemplo E. coli, se añade un residuo de metionina al extremo N-terminal de la secuencia de aminoácidos del anticuerpo original. Tales anticuerpos se incluyen en la presente divulgación.

Producción de anticuerpos Los anticuerpos tal como se dan a conocer en el presente documento pueden ser anticuerpos policlonales o monoclonales. Tales anticuerpos monoclonales que tienen actividad de neutralización de y/o unión a NR10 pueden obtenerse, por ejemplo, mediante el siguiente procedimiento: se preparan anticuerpos anti-NR10 monoclonales usando como antígeno NR10 o un fragmento del mismo que se deriva de un mamífero tal como ser humano o ratón mediante métodos conocidos, y entonces se seleccionan anticuerpos que tienen actividad de neutralización de y/o unión a NR10 a partir de los anticuerpos anti-NR10 monoclonales así obtenidos. Específicamente, se usan un antígeno deseado o células que expresan el antígeno deseado como antígeno de sensibilización para la inmunización según métodos de inmunización convencionales. Pueden prepararse anticuerpos anti-NR10 monoclonales fusionando las células inmunitarias obtenidas con células parentales conocidas usando métodos de fusión celular convencionales, y examinándolas para detectar células que producen anticuerpos monoclonales (hibridomas) mediante métodos de examen convencionales. Los animales que van a inmunizarse incluyen, por ejemplo, mamíferos tales como ratones, ratas, conejos, ovejas, monos, cabras, asnos, vacas, caballos y cerdos. El antígeno puede prepararse usando la secuencia génica de NR10 conocida según métodos conocidos, por ejemplo, mediante métodos que usan baculovirus (por ejemplo, documento WO 98/46777).

Pueden prepararse hibridomas, por ejemplo, según el método de Milstein et al. (Kohler, G. y Milstein, C., Methods Enzymol. (1981) 73: 3-46) o similares. Cuando la inmunogenicidad de un antígeno es baja, la inmunización puede realizarse tras unir antígeno a una macromolécula que tiene inmunogenicidad, tal como albúmina.

Las realizaciones de los anticuerpos tal como se dan a conocer en el presente documento que tienen una actividad de unión a y/o actividad de neutralización contra NR10 incluyen anticuerpos monoclonales que tienen una actividad de unión a y/o neutralización contra NR10 humano. Los antígenos usados para preparar anticuerpos monoclonales, que tienen una actividad de unión a y/o neutralización contra NR10 no están particularmente limitados, siempre que permitan la preparación de anticuerpos que tienen una actividad de unión a y/o actividad de neutralización contra NR10 humano. Por ejemplo, se sabe que hay varias variantes de NR10 humano, y puede usarse cualquier variante como inmunógeno siempre que permita la preparación de anticuerpos que tiene una actividad de unión a y/o actividad de neutralización contra NR10 humano. Alternativamente, en la misma condición, un fragmento peptídico de NR10 o una proteína en la que se han introducido mutaciones artificiales en la secuencia de NR10 natural puede usarse como inmunógeno. NR10.3 humano es uno de los inmunógenos preferidos en la preparación de anticuerpos que tienen una actividad de unión a y/o neutralización de NR10 en la presente invención.

Además, la actividad de unión a y/o neutralización de anticuerpo contra NR10 puede medirse, por ejemplo, observando el efecto de supresión del crecimiento de la línea celular dependiente de IL-31 tal como se describe en los ejemplos.

Mientras tanto, también pueden obtenerse anticuerpos monoclonales mediante inmunización con ADN. La inmunización con ADN es un método en el que se administra al animal un ADN de vector construido de manera que pueda expresarse el gen que codifica para una proteína antigénica en un animal que va a inmunizarse, y el inmunógeno se expresa dentro del cuerpo del animal para proporcionar inmunoestimulación. En comparación con métodos de inmunización comunes basados en la administración de antígenos proteicos, se espera que la inmunización con ADN sea ventajosa porque: - permite la inmunoestimulación al mismo tiempo que se retiene la estructura de una proteína de membrana; y - no es necesario purificar el inmunógeno.

Por otro lado, es difícil combinar la inmunización con ADN con un medio de inmunoestimulación tal como un adyuvante.

Con el fin de obtener un anticuerpo monoclonal mediante inmunización con ADN, en primer lugar, se administra ADN que codifica para NR10 a un animal que va a inmunizarse. El ADN que codifica para NR10 puede sintetizarse mediante métodos conocidos tales como PCR. El ADN resultante se inserta en un vector de expresión apropiado, y se administra al animal que va a inmunizarse. Los vectores de expresión que pueden usarse incluyen vectores de expresión disponibles comercialmente tales como pcDNA3.1. El vector puede administrarse al organismo vivo mediante métodos convencionales. Por ejemplo, la inmunización con ADN puede llevarse a cabo introduciendo partículas de oro recubiertas con el vector de expresión en células mediante una pistola génica. El refuerzo usando células que expresan NR10 tras la inmunización con ADN es un método preferido para producir un anticuerpo monoclonal.

Una vez se ha inmunizado el mamífero tal como se describió anteriormente y se ha confirmado que el nivel en suero de un anticuerpo deseado aumenta, se recogen células inmunitarias del mamífero y se someten a fusión celular. Células inmunitarias preferidas son células de bazo en particular.

Se usan células de mieloma de mamífero para la fusión con las células inmunitarias anteriores. Se prefiere que las células de mieloma tengan marcadores de selección apropiados para su examen. El marcador de selección se refiere a un fenotipo que permite (o no permite) la supervivencia en condiciones de cultivo particulares. Los marcadores de selección conocidos incluyen deficiencia de hipoxantina-guanina fosforribosiltransferasa (a continuación en el presente documento abreviada como “deficiencia de HGPRT”) y deficiencia de timidina cinasa (a continuación en el presente documento abreviada como “deficiencia de TK”). Células deficientes en HGPRT o TK presentan sensibilidad a hipoxantina-aminopterina-timidina (a continuación en el presente documento abreviada como “sensibilidad a HAT”). En medio de selección con HAT, las células sensibles a HAT no pueden sintetizar ADN y por tanto morirán. Sin embargo, cuando se fusionan con células normales, pueden seguir sintetizando ADN por medio de la ruta salvaje de las células normales y por tanto pueden crecer incluso en medio de selección con HAT.

Pueden seleccionarse células deficientes en HGPRT o TK usando un medio que contiene 6-tioguanina, 8- azaguanina (a continuación en el presente documento abreviada como “8AG”) o 5’-bromodesoxiuridina. Mientras que las células normales mueren debido a la incorporación de estos análogos de pirimidina al ADN, las células que carecen de estas enzimas pueden sobrevivir en el medio de selección debido a que no pueden incorporar estos análogos de pirimidina. Otro marcador de selección denominado resistencia a G418 confiere resistencia a antibióticos de 2-desoxiestreptamina (análogos de gentamicina) debido al gen de resistencia a neomicina. Se conocen diversas células de mieloma adecuadas para la fusión celular.

La fusión celular entre células inmunitarias y células de mieloma puede llevarse a cabo esencialmente según métodos conocidos, por ejemplo, el método de Kohler y Milstein (Kohler. G. y Milstein, C., Methods Enzymol. (1981) 73, 3-46).

Más específicamente, la fusión celular puede llevarse a cabo, por ejemplo, en un medio de cultivo común en presencia de un agente que promueve la fusión celular. El agente que promueve la fusión incluye, por ejemplo, polietilenglicol (PEG) y virus Sendai (HVJ). Si se requiere, también puede añadirse un agente auxiliar tal como dimetilsulfóxido para mejorar la eficacia de fusión.

Las células inmunitarias y las células de mieloma pueden usarse a una razón determinada arbitraria. Por ejemplo, la razón de células inmunitarias con respecto a células de mieloma es preferiblemente de desde 1 hasta 10. Los medios de cultivo que van a usarse para la fusión celular incluyen, por ejemplo, medios que son adecuados para el crecimiento celular de la línea celular de mieloma, tal como RPMI 1640 y MEM, y otros medios de cultivo comunes usados para este tipo de cultivo celular. Además, los medios de cultivo también pueden complementarse con complemento de suero tal como suero de ternero fetal (FCS).

Se mezclan bien cantidades predeterminadas de células inmunitarias y células de mieloma en el medio de cultivo, y entonces se mezclan con una disolución de PEG precalentada hasta 37ºC para producir células fusionadas (hibridomas). En el método de fusión celular, por ejemplo, puede añadirse PEG con peso molecular medio de aproximadamente 1.000-6.000 a las células normalmente a una concentración del 30% al 60% (p/v). Entonces, se repiten la adición sucesiva del medio de cultivo apropiado enumerado anteriormente y la eliminación del sobrenadante mediante centrifugación para eliminar el agente de fusión celular y similar, que no son favorables para el crecimiento de hibridomas.

Los hibridomas resultantes pueden examinarse usando un medio de selección según el marcador de selección que presentan las células de mieloma usadas en la fusión celular. Por ejemplo, células deficientes en HGPRT o TK pueden examinarse cultivándolas en un medio con HAT (un medio que contienen hipoxantina, aminopterina y timidina). Específicamente, cuando se usan células de mieloma sensibles a HAT en la fusión celular, pueden hacerse crecer selectivamente en el medio con HAT células fusionadas de manera satisfactoria con células normales. El cultivo celular usando el medio con HAT anterior se continúa durante un periodo de tiempo suficiente para permitir que todas las células excepto los hibridomas deseados (células no fusionadas) mueran. Específicamente, en general, los hibridomas deseados pueden seleccionarse cultivando las células durante de varios días a varias semanas. Entonces, pueden llevarse a cabo el examen y la clonación individual de hibridomas que producen un anticuerpo de interés realizando métodos de dilución limitante habituales. Alternativamente, pueden preparase anticuerpos que reconocen NR10 mediante el método descrito en el documento WO 03/104453.

El examen y la clonación individual de un anticuerpo de interés pueden llevarse a cabo adecuadamente mediante métodos de examen conocidos basados en la reacción antígeno-anticuerpo. Por ejemplo, un antígeno se une a un portador tal como perlas hechas de poliestireno o similares y placas de microtitulación de 96 pocillos disponibles comercialmente, y entonces se hacen reaccionar con el sobrenadante de cultivo del hibridoma. A continuación, el portador se lava y entonces se hace reaccionar con un anticuerpo secundario marcado enzimáticamente o similar. Cuando el sobrenadante de cultivo contiene un anticuerpo de interés reactivo frente al antígeno de sensibilización, el anticuerpo secundario se une al portador por medio de este anticuerpo. Finalmente, el anticuerpo secundario unido al portador se detecta para determinar si el sobrenadante de cultivo contiene el anticuerpo de interés. Pueden clonarse hibridomas que producen un anticuerpo deseado que puede unirse al antígeno mediante el método de dilución limitante o similar. No sólo el antígeno usado para la inmunización sino también una proteína NR10 sustancialmente equivalente al mismo pueden usarse preferiblemente como antígeno para este fin. Por ejemplo, puede usarse como antígeno una línea celular que expresa NR10, el dominio extracelular de NR10 o un oligopéptido compuesto por una secuencia de aminoácidos parcial que constituye el dominio.

Además del método descrito anteriormente para preparar hibridomas a través de la inmunización de un animal no humano con un antígeno, también pueden obtenerse anticuerpos de interés sensibilizando linfocitos humanos con un antígeno. Específicamente, en primer lugar, se sensibilizan linfocitos humanos con una proteína NR10 in vitro. Entonces, los linfocitos sensibilizados se fusionan con un compañero de fusión apropiado. Por ejemplo, pueden usarse células de mieloma derivadas de ser humano con la capacidad para dividirse permanentemente como compañero de fusión (véase la publicación de solicitud de patente japonesa Kokoku n.º (JP-B) H1-59878 (solicitud de patente japonesa examinada, aprobada publicada para oposición). Anticuerpos obtenidos mediante este método son anticuerpos humanos que tienen una actividad de unión a la proteína NR10.

La secuencia de nucleótidos que codifica para un anticuerpo anti-NR10 obtenido mediante el método descrito anteriormente o similar, y su secuencia de aminoácidos pueden obtenerse mediante métodos conocidos por los expertos en la técnica. Los aminoácidos contenidos en las secuencias de aminoácidos descritas en la presente invención pueden experimentar modificación postraduccional (por ejemplo, la modificación de la glutamina N- terminal para dar ácido piroglutámico mediante piroglutamilación la conocen bien los expertos en la técnica). Por supuesto, tales secuencias con aminoácidos modificados postraduccionalmente también se incluyen en las secuencias de aminoácidos descritas en la presente invención.

Basándose en la secuencia obtenida del anticuerpo anti-NR10, el anticuerpo anti-NR10 puede prepararse, por ejemplo, mediante técnicas de recombinación genética conocidas por los expertos en la técnica. Específicamente, puede construirse un polinucleótido que codifica para un anticuerpo basándose en la secuencia del anticuerpo que reconoce a NR10, insertarse en un vector de expresión y luego expresarse en células huésped apropiadas (véanse por ejemplo, Co, M. S. et al., J. Immunol. (1994) 152, 2968-2976; Better, M. y Horwitz, A. H., Methods Enzymol.

(1989) 178, 476-496; Pluckthun, A. y Skerra, A., Methods Enzymol. (1989) 178,497-515; Lamoyi, E., Methods Enzymol. (1986) 121, 652-663; Rousseaux, J. et al., Methods Enzymol. (1986) 121, 663-669; Bird, R. E. y Walquer, B. W., Trends Biotechnol. (1991) 9,132-137).

Los vectores incluyen vectores M13, vectores pUC, pBR322, pBluescript y pCR-Script. Alternativamente, cuando el objetivo es subclonar y cortar ADNc, los vectores incluyen, por ejemplo, pGEM-T, pDIRECT y pT7, además de los vectores descritos anteriormente. Los vectores de expresión son particularmente útiles cuando se usan vectores para producir los anticuerpos de la presente invención. Por ejemplo, cuando el objetivo es la expresión en E. coli tal como JM109, DH5, HB101 y XL1-Blue, los vectores de expresión no sólo tienen las características descritas anteriormente que permiten la amplificación del vector en E. coli, sino que también pueden portar un promotor que permite la expresión eficaz en E. coli, por ejemplo, promotor de lacZ (Ward et al., Nature (1989) 341, 544-546; FASEB J. (1992) 6, 2422-2427), promotor de araB (Better et al., Science (1988) 240, 1041-1043), promotor de T7 o similar. Tales vectores incluyen pGEX-5X-1 (Pharmacia), “sistema QIAexpress” (Qiagen), pEGFP o pET (en este caso, el huésped es preferiblemente BL21 que expresa ARN polimerasa de T7) además de los vectores descritos anteriormente.

Los vectores pueden contener secuencias señal para la secreción de anticuerpos. Como secuencia señal para la secreción de anticuerpos, puede usarse una secuencia señal pelB (Lei, S. P. et al J. Bacteriol. (1987) 169, 4379) cuando se secreta una proteína al periplasma de E. coli. El vector puede introducirse en células huésped mediante métodos de cloruro de calcio o de electroporación, por ejemplo.

Además de los vectores para E. coli, los vectores para producir los anticuerpos de la presente invención incluyen vectores de expresión de mamíferos (por ejemplo, pcDNA3 (Invitrogen), pEF-BOS (Nucleic Acids. Res. 1990, 18(17), p5322), pEF y pCDM8), vectores de expresión derivados de células de insecto (por ejemplo, el “sistema de expresión de baculovirus Bac-to-BAC” (Gibco-BRL) y pBacPAK8), vectores de expresión derivados de plantas (por ejemplo, pMH1 y pMH2), vectores de expresión derivados de virus animales (por ejemplo, pHSV, pMV y pAdexLcw), vectores de expresión retrovirales (por ejemplo, pZIPneo), vectores de expresión de levaduras (por ejemplo, “kit de expresión en Pichia” (Invitrogen), pNV11 y SP-Q01), y vectores de expresión de Bacillus subtilis (por ejemplo, pPL608 y pKTH50), por ejemplo.

Cuando el objetivo es la expresión en células animales tales como células CHO, COS y NIH3T3, los vectores deben tener un promotor esencial para la expresión en células, por ejemplo, promotor de SV40 (Mulligan et al., Nature (1979) 277, 108), promotor de LTR de VLMM; promotor de EF1 (Mizushima et al., Nucleic Acids Res. (1990) 18, 5322) y promotor de CMV, y más preferiblemente tienen un gen para seleccionar células transformadas (por ejemplo, un gen de resistencia a fármaco que permite la evaluación usando un agente (neomicina, G418, o similar). Los vectores con tales características incluyen pMAM, pDR2, pBK-RSV, pBKCMV, pOPRSV y pOP13, por ejemplo.

Además, el siguiente método puede usarse para la expresión génica estable y la amplificación génica en células: se introduce en células CHO deficientes en una ruta de síntesis de ácido nucleico un vector (por ejemplo, pSV2-dhfr (Molecular Cloning 2ª edición, Cold Spring Harbor Laboratory Press, 1989)) que porta un gen de DHFR que compensa la deficiencia, y el vector se amplifica usando metotrexato (MTX). Alternativamente, el siguiente método puede usarse para la expresión génica transitoria: Se transforman células COS con un gen que expresa antígeno T de SV40 en su cromosoma con un vector (pcD y similar) con un origen de replicación de SV40. También pueden usarse orígenes de replicación derivados de poliomavirus, adenovirus, virus del papiloma bovino (VPB), y similares. Para amplificar el número de copias del gen en células huésped, los vectores de expresión pueden portar adicionalmente marcadores de selección tales como gen de aminoglicósido transferasa (APH), gen de timidina cinasa (TK), gen de xantina-guanina fosforribosiltransferasa (Ecogpt) de E. coli y gen de dihidrofolato reductasa (dhfr).

Por tanto, se dan a conocer métodos para producir los polipéptidos de la presente invención o polipéptidos codificados por genes que codifican para los polipéptidos de la presente invención, que comprenden la etapa de cultivar células huésped que contienen un vector en el que se ha introducido un polinucleótido que codifica para el polipéptido de la presente invención.

Más específicamente, se dan a conocer métodos para producir los polipéptidos de la presente invención, que comprenden las etapas de: (a) cultivar una célula huésped que contiene un vector en el que se ha introducido un gen que codifica para el polipéptido de la presente invención; y (b) obtener el polipéptido codificado por el gen.

Los anticuerpos tal como se dan a conocer en el presente documento obtenidos mediante los métodos descritos anteriormente pueden aislarse del interior de células huésped o del exterior de las células (el medio, o similar), y purificarse hasta la homogeneidad. Los anticuerpos pueden aislarse y purificarse mediante métodos usados de manera rutinaria para aislar y purificar anticuerpos, y el tipo de método no está limitado. Por ejemplo, los anticuerpos pueden aislarse y purificarse seleccionando y combinando apropiadamente cromatografía en columna, filtración, ultrafiltración, precipitación con sales, precipitación con disolvente, extracción con disolvente, destilación, inmunoprecipitación, electroforesis en gel de SDS-poliacrilamida, isoelectroenfoque, diálisis, recristalización, y similares.

Las cromatografías incluyen, por ejemplo, cromatografía de afinidad, cromatografía de intercambio iónico, cromatografía hidrófoba, filtración en gel, cromatografía de fase inversa y cromatografía de adsorción (Strategies for Protein Purification and Characterization: A Laboratory Course Manual. Ed Daniel R. Marshak et al., Cold Spring Harbor Laboratory Press, 1996). Los métodos cromatográficos descritos anteriormente pueden realizarse usando cromatografía de líquidos, por ejemplo, HPLC y FPLC. Las columnas que pueden usarse para la cromatografía de afinidad incluyen columnas de proteína A y columnas de proteína G. Las columnas que usan proteína A incluyen, por ejemplo, Hiper D, POROS y Sepharose FF (GE Amersham Biosciences). Se dan a conocer anticuerpos que se purifican altamente usando estos métodos de purificación.

La actividad de unión a NR10 de los anticuerpos obtenidos puede determinarse mediante métodos conocidos por los expertos en la técnica. Los métodos para determinar la actividad de unión a antígeno de un anticuerpo incluyen, por ejemplo, ELISA (ensayo de inmunoabsorción ligado a enzimas), EIA (inmunoensayo enzimático), RIA (radioinmunoensayo) y método de anticuerpos fluorescentes. Por ejemplo, cuando se usa inmunoensayo enzimático, se añaden muestras que contienen anticuerpos, tales como anticuerpos purificados y sobrenadantes de cultivo de células que producen anticuerpos, a placas recubiertas con antígeno. Se añade un anticuerpo secundario marcado con una enzima, tal como fosfatasa alcalina, y se incuban las placas. Tras lavar, se añade un sustrato enzimático, tal como fosfato de p-nitrofenilo, y se mide la absorbancia para evaluar la actividad de unión a antígeno.

Composiciones farmacéuticas La presente invención también proporciona composiciones farmacéuticas que comprenden el anticuerpo mencionado anteriormente como principio activo. Además, la presente invención proporciona agentes terapéuticos para enfermedades inflamatorias que comprenden el anticuerpo mencionado anteriormente como principio activo.

En la presente invención, enfermedad inflamatoria se refiere a enfermedades con características patológicas implicadas en reacciones citológicas e histológicas que se producen en vasos sanguíneos afectados y tejidos adyacentes en respuesta a una lesión o estimulación anómala provocada por agentes físicos, químicos o biológicos (Stedman’s Medical Dictionary, 5ª Ed., MEDICAL VIEW CO., 2005). Generalmente, las enfermedades inflamatorias incluyen, dermatitis (dermatitis atópica, dermatitis crónica, y similares), enfermedades inflamatorias del intestino (colitis y similar), asma, artritis (artritis reumatoide, osteoartritis, y similares), bronquitis, enfermedades autoinmunitarias Th2, lupus eritematoso sistémico, miastenia grave, EICH crónica, enfermedad de Crohn, espondilitis deformante, lumbalgia, gota, inflamación tras cirugía o lesión, hinchazón, neuralgia, laringofaringitis, cistitis, hepatitis (esteatohepatitis no alcohólica, hepatitis alcohólica, y similares), hepatitis B, hepatitis C, arteriosclerosis y prurito.

Los ejemplos preferidos de enfermedades inflamatorias que son objetos de la presente invención incluyen dermatitis atópica, dermatitis crónica, reumatismo, osteoartritis, asma crónica y prurito.

La expresión “comprende(n) un anticuerpo anti-NR10 como principio activo” significa que comprende un anticuerpo anti-NR10 como al menos uno de los principios activos, y no limita la proporción del anticuerpo. Además, los agentes terapéuticos para enfermedades inflamatorias en la presente invención pueden comprender también, en combinación con el anticuerpo anti-NR10 mencionado anteriormente, otros componentes que potencian el tratamiento de enfermedades inflamatorias.

Los agentes terapéuticos de la presente invención también pueden usarse para fines preventivos.

El anticuerpo anti-NR10 de la presente invención puede prepararse como formulaciones según métodos convencionales (véase, por ejemplo, Remington’s Pharmaceutical Science, última edición, Mark Publishing Company, Easton, EE.UU.). Adicionalmente, pueden contener portadores y/o aditivos farmacéuticamente aceptables si es necesario. Por ejemplo, pueden contener tensioactivos (por ejemplo, PEG y Tween), excipientes, antioxidantes (por ejemplo, ácido ascórbico), agentes colorantes, agentes saborizantes, conservantes, estabilizadores, agentes tamponantes (por ejemplo, ácido fosfórico, ácido cítrico y otros ácidos orgánicos), agentes quelantes (por ejemplo, EDTA), agentes de suspensión, agentes de isotonización, aglutinantes, disgregantes, lubricantes, promotores de la fluidez y correctores. Sin embargo, sin limitación a estos, los agentes para prevenir o tratar enfermedades inflamatorias de la presente invención pueden contener otros portadores usados comúnmente. Tales portadores incluyen específicamente ácido silícico anhidro ligero, lactosa, celulosa cristalina, manitol, almidón, carmelosa cálcica, carmelosa sódica, hidroxipropilcelulosa, hidroxipropilmetilcelulosa, poli(aminoacetato de vinilacetaldietilo), polivinilpirrolidona, gelatina, triglicérido de ácidos grasos de cadena media, aceite de ricino hidrogenado de polioxietileno 60, sacarosa, carboximetilcelulosa, almidón de maíz y sal inorgánica. Los agentes también pueden contener otros polipéptidos de bajo peso molecular, proteínas tales como albúmina sérica, gelatina e inmunoglobulina, y aminoácidos tales como glicina, glutamina, asparagina, arginina y lisina. Cuando el anticuerpo anti-NR10 se prepara como una disolución acuosa para inyección, el anticuerpo anti-NR10 puede disolverse en una disolución isotónica que contiene, por ejemplo, solución salina fisiológica, dextrosa u otros adyuvantes. Los adyuvantes pueden incluir, por ejemplo, D-sorbitol, D-manosa, D-manitol y cloruro de sodio. Además, pueden usarse simultáneamente agentes de solubilización apropiados, por ejemplo, alcoholes (por ejemplo, etanol), polialcoholes (por ejemplo, propilenglicoles y PEG) y detergentes no iónicos (polisorbato 80 y HCO-50).

Si es necesario, pueden encapsularse anticuerpos anti-NR10 en microcápsulas (microcápsulas hechas de hidroximetilcelulosa, gelatina, poli(metacrilato de metilo), y similares), y prepararse para dar componentes de sistemas de administración de fármacos coloidales (liposomas, microesferas de albúmina, microemulsiones, nanopartículas y nanocápsulas) (por ejemplo, véase “Remington’s Pharmaceutical Science 16ª edición” &, Oslo Ed. (1980)). Además, se conocen métodos para preparar fármacos de liberación sostenida, y estos pueden aplicarse para anticuerpos anti-NR10 (Langer et al., J. Biomed. Mater. Res. (1981) 15, 167-277; Langer, Chem. Tech. (1982) 12, 98-105; patente estadounidense n.º 3.773.919; solicitud de patente europea (EP) n.º 58.481; Sidman et al., Biopolimers (1983) 22, 47-56; documento EP 133.988).

Las composiciones farmacéuticas de la presente invención pueden administrarse o bien por vía oral o bien por vía parenteral, pero se administran preferiblemente por vía parenteral. Específicamente, los agentes se administran a pacientes mediante inyección o administración percutánea. Las inyecciones incluyen, por ejemplo, inyecciones intravenosas, inyecciones intramusculares e inyecciones subcutáneas, para administración sistémica o local. Los agentes pueden administrarse a sitios en los que debe suprimirse la inflamación, o zonas que rodean a los sitios de infusión local, inyección intramuscular en particular. Los métodos de administración pueden seleccionarse apropiadamente según la edad y el estado del paciente. La dosis de administración única puede seleccionarse, por ejemplo, desde dentro del intervalo de 0,0001 hasta 100 mg del principio activo por kg de peso corporal.

Alternativamente, por ejemplo, cuando los agentes se administran a pacientes humanos, la dosis del principio activo puede seleccionarse desde dentro del intervalo de 0,001 hasta 1.000 mg/kg de peso corporal. La dosis de administración única contiene preferiblemente, por ejemplo, de aproximadamente 0,01 a 50 mg/kg de peso corporal del anticuerpo de la presente invención. Sin embargo, la dosis de un agente para prevenir o tratar enfermedades inflamatorias de la presente invención no se limita a estos ejemplos.

Ejemplos

A continuación en el presente documento, la presente invención se describirá específicamente con referencia a los ejemplos, pero no ha de interpretarse como que se limita a los mismos.

[Ejemplo 1] Preparación de hibridomas 1.1. Preparación de plásmidos de NR10 humana y de macaco cangrejero para la inmunización con ADN 1.1.1. Preparación de vectores de expresión para hNR10 y cynNR10 Se insertó NR10 humana (secuencia de nucleótidos, SEQ ID NO: 75; secuencia de aminoácidos, SEQ ID NO: 76) en el vector de expresión pMacII, que expresa una proteína bajo el control de promotor de -actina de ratón (documento WO2005/054467), para preparar un vector de expresión para hNR10. De la misma manera, se construyó un vector de expresión para cynNR10 a partir de NR10 de macaco cangrejero (secuencia de nucleótidos, SEQ ID NO: 65; secuencia de aminoácidos, SEQ ID NO: 66).

1.1.2. Preparación de cartucho de ADN Con el fin de usar el vector de expresión hNR10 o cynNR10 preparado en 1.1.1 para la inmunización con ADN de ratones, se usó el kit de cartucho de pistola génica Helios (BIO-RAD) para producir un cartucho de ADN para cada ADN que permite la inmunización con 1 g de ADN de una vez.

1.2. Preparación de hibridomas que producen anticuerpo anti-NR10 humana 1.2.1. Preparación de hibridomas usando ratones inmunizados con NR10 humana o de macaco cangrejero Se inmunizaron diez ratones Balb/c (hembra; de seis semanas de edad al comienzo de la inmunización; Charles River Laboratories Japan) con NR10 humana o de macaco cangrejero mediante el siguiente procedimiento. Para la inmunización primaria, se inmunizaron los ratones con el cartucho de ADN preparado con el vector de expresión hNR10 usando el sistema de pistola génica Helios (BIO-RAD). Una semana después, se realizó una inmunización secundaria mediante el sistema de pistola génica Helios (BIORAD) usando el cartucho de ADN preparado con el vector de expresión cynNR10. Se llevaron a cabo las inmunizaciones tercera y posteriores a intervalos de una semana usando los vectores de expresión hNR10 y cynNR10 alternativamente. Tras confirmarse que el título de anticuerpo contra NR10 humana en suero estaba elevado, se administró por vía intravenosa una proteína NR10 humana (dominio extracelular) (ejemplo de referencia 4) diluida con PBS(-) a 10 g/cabeza como inmunización final. Cuatro días tras la inmunización final, se fusionaron células de bazo de ratón con células de mieloma de ratón P3X63Ag8U.1 (abreviado como P3U1; ATCC CRL-1597) mediante un método convencional usando PEG1500 (Roche Diagnostics). Se cultivaron las células fusionadas resultantes, es decir, hibridomas, en RPMI1640 suplementado con FBS al 10% (a continuación en el presente documento abreviado como FBS al 10%/RPMI1640).

1.2.2. Selección de hibridomas Al día siguiente de la fusión, se suspendieron las células fusionadas en un medio semisólido (StemCells), y se cultivaron para selección así como colonización de hibridomas.

Tras nueve o diez días desde la fusión, se recogieron las colonias de hibridomas y se sembró cada colonia en cada pocillo de placas de 96 pocillos que contenían el medio de selección HAT (FBS al 10%/ RPMI1640, el 2% vol. de concentrado 50x de HAT (Dainippon Pharmaceutical) y el 5% vol. de BM-Condimed H1 (Roche Diagnostics)). Tras de tres a cuatro días de cultivo, se recogió el sobrenadante de cultivo de cada pocillo para determinar la concentración de ratón IgG en el sobrenadante. Se evaluaron los sobrenadantes de cultivo en los que se detectó IgG de ratón para determinar una actividad de neutralización usando una línea celular dependiente de IL-31 humana (células hNR10/hOSMR/BaF3; ejemplo de referencia 2), y se obtuvieron varios clones que tenían una fuerte actividad de neutralización de NR10 (figura 3). Se obtuvieron clones que suprimían el crecimiento inducido por IL-31 humana de células de manera dependiente de la concentración y suprimían el crecimiento inducido por IL-31 de macaco cangrejero de células (células cynNR10/cynOSMR/BaF3; ejemplo de referencia 2) de manera dependiente de la concentración (figura 4).

[Ejemplo 2] Preparación de anticuerpos quiméricos Preparación de vectores de expresión para anticuerpos quiméricos Se extrajeron los ARN totales de los hibridomas usando minikits RNeasy (QIAGEN), y se sinterizaron ADNc a partir de ellos usando el kit de amplificación de ADNc SMART RACE (BD Biosciences). Se aislaron genes de región variable de anticuerpo mediante PCR usando ADN polimerasa PrimeSTAR HS (TaKaRa), mezcla de cebador A universal 10x adjunta al kit de amplificación de ADNc SMART RACE (BD Biosciences), y cebadores diseñados para cada región constante de anticuerpo (cadena H, mIgG1-rnot; cadena L, mIgK-rnot). Se determinó la secuencia de nucleótidos de cada fragmento de ADN aislado con el secuenciador de ADN ABI PRISM 3730xL o el secuenciador de ADN ABI PRISM 3700 (Applied Biosystems), usando el kit de secuenciación de ciclo con terminador BigDye (Applied Biosystems) según el método descrito en el manual de instrucciones adjunto. Las secuencias de aminoácidos determinadas de regiones variables de cadena H y cadena L en los anticuerpos de ratón NS18, NS22, NS23 y NS33 se muestran en las figuras 1 y 2, respectivamente.

Se sometió cada uno de los fragmentos de cadena H y L resultantes a PCR usando ADN polimerasa PrimeSTAR HS (TaKaRa) y los conjuntos de cebadores mostrados en la tabla 1. Se ligaron los fragmentos amplificados resultantes con la región constante (1 o 2 humana, y  humana, respectivamente), y entonces se insertaron en un vector de expresión en células animales. Se determinó la secuencia de nucleótidos de cada fragmento de ADN con el secuenciador de ADN ABI PRISM 3730xL o el secuenciador de ADN ABI PRISM 3700 (Applied Biosystems), usando el kit de secuenciación de ciclo con terminador BigDye (Applied Biosystems) según el método descrito en el manual de instrucciones adjunto.

Tabla 1 Secuencia (5’  3’) SEQ ID NO: mIgG1-rnot 90 mIgK-rnot 91 mNS18H-feco 92 mNS18L-feco 93 mNS33H-feco 94 mNS33L-feco 95 Cebador directo Cebador inverso Cadena H de NS18 mNS18H-feco mIG1-rnot Cadena L de NS18 mNS18L-feco mIGK-rnot Cadena H de NS22 mNS18H-feco mIG1-rnot Cadena L de NS22 mNS18L-feco mIGK-rnot Cadena H de NS23 mNS18H-feco mIG1-rnot Cadena L de NS23 mNS18L-feco mIGK-rnot Cadena H de NS33 mNS33H-feco mIG1-rnot Cadena L de NS33 mNS33L-feco mIGK-rnot Preparación de anticuerpos quiméricos Se suspendió la línea celular de cáncer de riñón embrionario humano HEK293H (Invitrogen) en DMEM (Invitrogen) suplementado con suero bovino fetal al 10% (Invitrogen), y se sembraron 10 ml de células en placas para células adherentes (10 cm de diámetro; CORNING) a una densidad celular de 6 x 105 células/ml. Se incubaron las células en un incubador de CO2 (37ºC, 5% de CO2) durante todo un día y una noche. Entonces, se retiró el medio mediante aspiración, y se añadieron 6,9 ml de medio CHO-S-SFMII (Invitrogen). Se añadió medio CHO-S-SFMII a la mezcla de ADN de plásmido preparada (13,8 g en total) hasta un volumen de 700 l. Esto se mezcló con 20,7 l de polietilenimina 1 g/ml (Polysciences Inc.), y se permitió que estuviera en reposo a temperatura ambiente durante 10 minutos. Se añadió la disolución a las células en cada placa. Se incubaron las células en un incubador de CO2 (37ºC, 5% de CO2) durante de cuatro a cinco horas. Entonces, se añadieron 6,9 ml de medio CHO-S-SFMII (Invitrogen), y se incubaron las células en un incubador de CO2 durante de tres a cuatro días. Se recogieron los sobrenadantes de cultivo y entonces se centrifugaron (aproximadamente 2000 g, cinco minutos, temperatura ambiente) para retirar las células. Se filtraron los sobrenadantes a través de un filtro de 0,22 m MILLEX®-GV (Millipore). Se almacenó cada muestra a 4ºC hasta su uso. Se purificaron los anticuerpos de los sobrenadantes usando proteína G-Sepharose (Amersham Biosciences). Se concentraron los anticuerpos purificados con Amicon Ultra 15 (Millipore), y entonces se sustituyó el disolvente por PBS(-) que contenía NaN3 al 0,05% usando columnas de desalación PD-10 (Amersham Biosciences). Se midió la absorbancia a 280 nm con un espectrofotómetro ND- 1000 (NanoDrop), y se determinaron las concentraciones mediante el método de Pace et al. (Protein Science (1995) 4: 2411-2423).

Evaluación de la actividad de NS22 quimérico Se evaluó la actividad de hIL-31 neutralizante usando la línea celular hNR10/hOSMR/BaF3, que crece de manera dependiente de la dosis de hIL-31, tal como se describe a continuación.

Se prepararon células hNR10/hOSMR/BaF3 a 1,5 x 105 células/ml usando medio RPMI1640 (GIBCO) que contenía FBS al 10% (MOREGATE) y penicilina al 1%-estreptomicina (Invitrogen). Se añadió hIL-31 (R&D Systems) a una alícuota de las células hasta una concentración final de 4 ng/ml (IL-31(+); conc. final: 2 ng/ml). Se usó la suspensión celular restante como IL-31(-). Se ajustó el NS22 purificado a 2 g/ml usando el medio, y se prepararon ocho diluciones en serie a una razón de dilución común de 3 (conc. final: 1 g/ml o menos). Se añadieron 50 l de cada una de la suspensión celular y la dilución de NS22 quimérico (1,  humana) a cada pocillo de placas de fondo plano de 96 pocillos (CORNING), y se cultivaron las células en un incubador con el 5% de CO2 a 37ºC durante dos días. Tras el cultivo, se añadieron 20 l de una mezcla de cantidades iguales de kit-8 de recuento celular (Dojindo) y PBS a cada pocillo, y se midió la absorbancia (450 nm/620 nm) (TECAN, SUNRISE CLASSIC). Tras permitirse que continuara la reacción durante dos horas en un incubador con el 5% de CO2 a 37ºC, se midió la absorbancia de nuevo. Se presentó la actividad de neutralización de NS22 como una tasa de inhibición usando un valor obtenido restando el valor a las 0 horas del valor a las 2 horas. El resultado mostró que NS22 suprimió el crecimiento inducido por IL-31 de la línea celular hNR10/hOSMR/ BaF3 de manera dependiente de la concentración. Esto demuestra que NS22 tiene una actividad de neutralización contra la señalización de IL-31 humana (figura 5).

Se evaluó la actividad de neutralización de IL-31 tal como se describe a continuación usando la línea celular DU145 (línea celular de cáncer de próstata humano), en la que se induce producción de IL-6 producción con la estimulación de IL-31.

Se prepararon células DU145 a 2,5 x 105 células/ml en MEM (Invitrogen) que contenía FBS al 10% (MOREGATE), L-glutamina 2 mmol/l (Invitrogen), y piruvato de sodio 1 mmol/l (SIGMA), y se dispensaron alícuotas de 200 l en cada pocillo de placas de 48 pocillos (CORNING). Se incubaron las células a 37ºC bajo el 5% de CO2 durante la noche. Se diluyó el NS22 quimérico purificado (1,  humana) hasta 100 g/ml con MEM que contenía FBS al 10%, L-glutamina 2 mmol/l y piruvato de sodio. Usando esta disolución, se prepararon seis diluciones en serie a una razón de dilución común de 5. Se combinó cada dilución con interleucina-31 humana 100 ng/ml (R&D Systems) a una razón de 1:1, y se añadió una alícuota de 50 l a cada pocillo. Tras dos días de cultivo a 37ºC bajo el 5% de CO2, se determinó la concentración de IL-6 en el sobrenadante de cultivo usando el kit de desarrollo de ELISA DuoSet (R&D Systems). Se evaluó la actividad de neutralización de NS22 determinando la tasa de inhibición (%).

Específicamente, suponiendo que la concentración de IL-6 en ausencia de IL-31 (A) como la actividad inhibidora máxima (inhibición del 100%) y la concentración de IL-6 en presencia de IL-31 sin NS22 (B) como ausencia de actividad inhibidora (inhibición del 0%), se determinó la concentración de IL-6 en presencia de IL-31 y NS22 (C) según la siguiente fórmula: Tasa de inhibición (%) = (B-C)/(B-A) x 100 El resultado mostró que NS22 suprimió la producción de IL-6 inducida por IL-31 en la línea celular DU145 de manera dependiente de la concentración y por tanto demostró que NS22 tenía una actividad de neutralización contra la señalización de IL-31 humana (figura 6).

Evaluación de competencia de anticuerpo quimérico anti-NR10 con IL-31 Se marcó IL-31 humana (R&D Systems) con colorante reactivo monofuncional FMAT Blue (Applied Biosystems). Se mezclaron 100 l de hIL-31 preparada a 0,5 mg/ml usando tampón fosfato de sodio 50 mM (pH 8,0) con 5,25 l de 25 nmol de FMAT Blue disueltos en DMSO (Junsei). Tras agitar en vórtex, se permitió que la mezcla estuviera en reposo a temperatura ambiente durante 15 minutos. Se terminó la reacción de conjugación de FMAT Blue con hIL- 31 añadiendo 5 l de Tris-HCl 1 M (pH 7,4) y 1,1 l de Tween20 al 10%, y entonces se separaron hIL-31 marcada con FMAT Blue y FMAT Blue sin reaccionar mediante filtración en gel usando una columna Superdex 75 (GE Healthcare, 17-0771-01) con disolución de desarrollo de Tween20 al 0,1%/PBS.

Se evaluaron los anticuerpos para determinar la actividad de inhibición de la unión de IL-31/NR10 usando células CHO que expresan hNR10 tal como se describe a continuación.

Se diluyeron NS22 y NA633 (la región constante de cada uno es 1, ) a una concentración apropiada usando tampón de ensayo (HEPES 10 mM, NaCl 140 mM, CaCl2 2,5 mM, MgCl2 3 mM, FBS al 2%, NaN3 al 0,01%), y entonces se prepararon siete diluciones en serie a una razón de dilución común de 2. Se añadieron las diluciones a 40 l/pocillo a placas (placas FMAT de 96 pocillos; Applied Biosystems). Entonces, se diluyó hIL-31 marcada con FMAT Blue 400 veces con tampón de ensayo y se añadió a 20 l/pocillo. Finalmente, se añadieron suspensiones celulares ajustadas a 2,5 x 105 células/ml usando tampón de ensayo a 40 l/pocillo (final 1 x 104 células/pocillo). Dos horas tras la adición de las células, se determinó la fluorescencia (FL1) usando el sistema de detección celular 8200 (Applied Biosystems). El resultado mostró que NS22 inhibió la unión de hIL-31/hNR10 de manera dependiente de la dosis, y demostró que su actividad fue superior a la de NA633 (figura 7).

[Ejemplo 3] Competencia de anticuerpo anti-NR10 contra NR10 Se marcó el anticuerpo NS22 purificado de un sobrenadante de cultivo de hibridomas con FMAT Blue (Applied Biosystems, 4328853). Se mezclaron 170 l de NS22 preparado a 1 mg/ml en PBS con 17 l de una disolución de NaHCO3 1 M y 3,4 l de FMAT Blue (17 nmol) disuelto en DMSO. Tras agitar en vórtex, se permitió que la mezcla estuviera en reposo a temperatura ambiente durante 30 minutos. Se terminó la reacción de conjugación de FMAT Blue con NS22 añadiendo 8 l de Tris-HCl 1 M (pH 7,4) y 1,9 l de Tween 20 al 1%, y entonces se separaron NS22 marcado con FMAT Blue (FMAT Blue-NS22) y FMAT Blue sin reaccionar mediante filtración en gel usando una columna Superdex 75 (GE Healthcare, 17-0771-01) con disolución de desarrollo de Tween20 al 0,01%/PBS.

Se examinó cada anticuerpo para determinar la inhibición de la unión del FMAT Blue-NS22 preparado a células CHO que expresan hNR10 (ejemplo de referencia 3) usando el sistema de detección celular 8200 (Applied Biosystems, 4342920). Se añadieron los anticuerpos quiméricos anti-NR10 (la región constante de cada uno es 1, ) a diversas concentraciones a cada pocillo que contenía 7500 células y FMAT Blue-NS22 8,8 x 10-2 g/ml. Se permitió que las células estuvieran en reposo en la oscuridad durante cuatro horas, y entonces se midió la señal fluorescente de FMAT Blue unido a las células. Se llevó a cabo la reacción en HEPES 10 mM-KOH que contenía CaCl2 2,5 mM, MgCl2 3 mM, NaCl 140 mM, FBS al 2%, y NaNO3 al 0,01%. El resultado se muestra en la figura 8. Se redujo el valor de fluorescencia FL1, que representa la unión de FMAT Blue-NS22 a células que expresan NR10, con el aumento de la concentración de anticuerpo NS22 o NS23. Por otra parte, apenas se redujo FL1 con el aumento de la concentración de anticuerpo NA633 (ejemplo de referencia 6) (figura 8).

[Ejemplo 4] Humanización de anticuerpo NS22 Selección de cada secuencia de región de marco Se compararon las regiones variables de anticuerpo NS22 de ratón con secuencias de línea germinal humana. Las secuencias de FR usadas para la humanización se resumen en la tabla 2. Se determinaron las CDR y las FR basándose en la numeración de Kabat. Las secuencias de región variable humanizadas de cadena H que se componen de FR1, FR2, FR3_1 y FR4, y que se componen de FR1, FR2, FR3_2 y FR4, que se enumeran en la tabla 2, se denominan H0-VH (SEQ ID NO: 50) y H1-VH (SEQ ID NO: 112), respectivamente. Mientras tanto, la secuencia de cadena L que se compone de FR1, FR2, FR3 y FR4 se denomina L0 (SEQ ID NO: 52).

Preparación de región variable para H0L0 de NS22 humanizado Se diseñaron ADN de oligos sintéticos para cada una de las cadenas H y L para construir las regiones variables de NS22 humanizado en las que las CDR de NS22 se injertan sobre las FR usadas para la humanización. Se mezclaron los ADN de oligos sintéticos respectivos, y entonces se sometieron a PCR de ensamblaje para construir un gen que codifica para la región variable de NS22 humanizado. Se llevó a cabo la PCR de ensamblaje usando KOD-Plus (TOYOBO) según las siguientes condiciones. Se calentó una mezcla de reacción que contenía 10 pmol de ADN de oligos sintéticos y el tampón de PCR adjunto, dNTP, MgSO4 y KOD-Plus a 94ºC durante cinco minutos.

Entonces se sometió la mezcla a dos ciclos de PCR de 94ºC durante dos minutos, 55ºC durante dos minutos y 68ºC durante dos minutos. Entonces, se añadieron 10 pmol de cada uno de un cebador en el que se ha añadido un sitio de restricción y secuencia Kozak al extremo 5’ de la región variable, y un cebador en el que se ha añadido un sitio de restricción al extremo 3’ de la región variable, y se sometieron a 35 ciclos de PCR de 94ºC durante 30 segundos, 55ºC durante 30 segundos, y 68ºC durante un minuto para producir un fragmento amplificado. Se clonó el fragmento amplificado resultante en el vector de clonación TOPO TA (TOYOBO), y se determinó su secuencia de nucleótidos mediante secuenciación. Se combinaron las regiones variables construidas con las regiones constantes para preparar H0-SKSC (SEQ ID NO: 54) y L0 (SEQ ID NO: 56). Se insertó el constructo resultante en un vector de expresión que puede expresar el gen insertado en células animales. Se determinó la secuencia de nucleótidos de cada fragmento de ADN usando el kit de secuenciación de ciclo con terminador BigDye (Applied Biosystems) con el secuenciador de ADN ABI PRISM 3730xL o el secuenciador de ADN ABI PRISM 3700 (Applied Biosystems) según el método descrito en el manual de instrucciones adjunto.

Preparación de región variable para H1 de NS22 humanizado Se generó H1-SKSC (SEQ ID NO: 130) sustituyendo la glutamina (E) en la posición de numeración de Kabat 73 en FR3 de H0-SKSC (SEQ ID NO: 54) por lisina (K). Se preparó el mutante usando el kit de mutagénesis dirigida al sitio disponible comercialmente QuikChange (Stratagene) según el manual de instrucciones adjunto.

Expresión de anticuerpo convertido con IgG Se realizó la expresión de anticuerpos mediante el método descrito a continuación. Se suspendió la línea celular derivada de células de cáncer renal fetal humano HEK293H (Invitrogen) en DMEM (Invitrogen) que contenía suero bovino fetal al 10% (Invitrogen), y se sembraron 10 ml de células a una densidad de 5-6 x 105 células/ml sobre placas para células adherentes (10 cm de diámetro; CORNING). Se incubaron las células en un incubador de CO2 (37ºC, 5% de CO2) durante todo un día y una noche. Entonces, se retiró el medio mediante aspiración, y se añadieron 6,9 ml de medio CHO-S-SFMII (Invitrogen) a las células. Se mezcló la mezcla de ADN de plásmido preparada (13,8 g en total) con 20,7 l de polietilenimina 1 g/ml (Polysciences Inc.) y 690 l de medio CHO-S- SFMII, y se permitió que estuviera en reposo a temperatura ambiente durante 10 minutos. Se añadió la mezcla a las células en cada placa, y se incubaron las células en un incubador de CO2 (5% de CO2, 37ºC) durante de cuatro a cinco horas. Entonces, se añadieron 6,9 ml de medio CHO-S-SFMII (Invitrogen), y se incubaron las células en un incubador de CO2 durante tres días. Se recogió el sobrenadante de cultivo y se centrifugó (aproximadamente 2000 g, cinco minutos, temperatura ambiente) para retirar las células. Entonces se esterilizó el sobrenadante mediante filtración a través de un filtro de 0,22 m MILLEX®-GV (Millipore). Se almacenó cada muestra a 4ºC hasta su uso.

Purificación de anticuerpo convertido con IgG Se añadieron 50 l de proteína Ar-Sepharose™ Fast Flow (Amersham Biosciences) suspendidos en TBS al sobrenadante de cultivo obtenido, y se mezclaron mediante inversión a 4ºC durante cuatro horas o más. Se transfirió la disolución a una copa de filtro de 0,22 m de Ultrafree®-MC (Millipore). Tras tres lavados con 500 l de TBS, se suspendió resina de proteína Ar-Sepharose ™ en 100 l de disolución acuosa de acetato de sodio 50 mM (pH 3,3), y se permitió que estuviera en reposo durante tres minutos para eluir el anticuerpo. Inmediatamente se neutralizó la disolución añadiendo 6,7 l de Tris-HCl 1,5 M (pH 7,8). Se realizó la elución dos veces y se obtuvieron 200 l de anticuerpo purificado. Se sometieron 2 l de la disolución que contenía anticuerpo al espectrofotómetro ND-1000 (NanoDrop) (espectrofotómetro Thermo Scientific NanoDrop™ 1000 (Thermo Scientific)) o se sometieron 50 l al espectrofotómetro DU-600 (BECKMAN) para medir la absorbancia a 280 nm, y se calculó la concentración de anticuerpo mediante el método de Pace et al. (Protein Science (1995) 4: 2411-2423).

Medición de competencia con IL-31 usando FMAT Se evaluaron los anticuerpos para determinar la actividad de inhibición de la unión de IL-31/NR10 usando células CHO que expresan hNR10 tal como se describe a continuación. Se diluyeron el anticuerpo quimérico NS22 y NS22_H0L0 (cadena H, H0-SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56) a una concentración apropiada usando tampón de ensayo (HEPES 10 mM, NaCl 140 mM, CaCl2 2,5 mM, MgCl2 3 mM, FBS al 2%, NaN3 al 0,01%, pH 7,4), y se prepararon ocho diluciones en serie adicionales a una razón de dilución común de 2. Se añadieron las diluciones a 40 l/pocillo a placas (placas FMAT de 96 pocillos, Applied Biosystems). Entonces, se diluyó hIL-31 marcada con FMAT Blue 400 veces con tampón de ensayo, y se añadió a 20 l/pocillo. Finalmente, se añadió una suspensión celular ajustada a 2,5 x 105 células/ml usando tampón de ensayo a 40 l/pocillo (final 1 x 104 células/pocillo). Dos horas tras la adición de las células, se midió la fluorescencia (FL1) usando el sistema de detección celular 8200 (Applied Biosystems).

El resultado mostró que, tal como se muestra en la figura 9, los anticuerpos NS22 humanizados H0L0 (cadena H, H0-SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56), y H1L0 (cadena H, H1-SKSC/SEQ ID NO: 130; cadena L, L0/SEQ ID NO: 56) presentaron una actividad de competencia comparable a la del anticuerpo quimérico, lo que sugiere que tanto H0L0 como H1L0 son anticuerpos anti-receptor de IL-31 humanizados. Además, se considera que las FR usadas para H0L0 y H1L0 pueden usarse para la humanización.

Por consiguiente, todas las mutaciones en CDR descritas en los ejemplos a continuación en el presente documento pueden introducirse tanto en H0 como en H1.

Tabla 2 H0 Línea germinal Secuencia de FR humana FR1 Línea germinal: hVH146 (n.º de registro QVQLVQSGAEVKKPGASVKVSCKASGYTFT X92343) (SEQ ID NO: 96) FR2 Línea germinal: hVH146 (n.º de registro WVRQAPGQGLEWMG (SEQ ID NO: 99) X92343) FR3_1 Línea germinal: hVH169 (n.º de registro RVTITADESTSTAYMELSSLRSEDTAVYYCAR L22582) (SEQ ID NO: 98) FR3_2 Línea germinal: hVH169 (n.º de registro RVTITADKSTSTAYMELSSLRSEDTAVYYCAR Z27506) (SEQ ID NO: 131) FR4 Línea germinal: JH1 WGQGTLVTVSS (SEQ ID NO: 99) L0 Línea germinal Secuencia de FR humana FR1 Línea germinal: hVK139 (n.º de registro DIQMTQSPSSLSASVGDRVTITC X59315) (SEQ ID NO: 100) FR2 Línea germinal: hVK139 (n.º de registro WYQQKPGKAPKLLIY (SEQ ID NO: 101) X59315) FR3 Línea germinal: hVK139 (n.º de registro GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC X59315) (SEQ ID NO: 102) FR4 Línea germinal: JK4 FGGGTKVEIK (SEQ ID NO: 103) [Ejemplo 5] Efecto de reducción de la heterogeneidad de regiones constantes novedosas M14 y M58 en anticuerpo anti-receptor de IL-31 humanizado Tal como se muestra en los ejemplos de referencia 7 a 9, se demostró que la conversión de la región constante de IgG2 a M14 o M58 en el anticuerpo huPM1, un anticuerpo anti-receptor de IL-6 humanizado, podía reducir la heterogeneidad derivada de la región bisagra de IgG2 sin pérdida de estabilidad. Por tanto, también se sometieron a prueba anticuerpos anti-receptor de IL-31 humanizados para evaluar si podía reducirse la heterogeneidad mediante la conversión de sus regiones constantes de IgG2 silvestre a M14 o M58.

Se usaron, como cadenas H, H0-M14, H0-M58, H0-IgG1 y H0-IgG2, que se generaron combinando IgG1 (SEQ ID NO: 60), IgG2 (SEQ ID NO: 132), M14 (SEQ ID NO: 129) y M58 (SEQ ID NO: 128) generados en los ejemplos de referencia 8 y 9, con la región variable H0 de cadena H (H0-VH/SEQ ID NO: 50) de anticuerpo anti-receptor de IL-31 humanizado generado en el ejemplo 4, y se usó, como cadena L, L0 (L0/SEQ ID NO: 56) producido en el ejemplo 4, para generar H0L0-IgG1 (cadena H, H0-IgG1/SEQ ID NO: 133; cadena L, L0/SEQ ID NO: 56), H0L0-IgG2 (cadena H, H0-IgG2/SEQ ID NO: 134; cadena L, L0/SEQ ID NO: 56), H0L0-M14 (cadena H, H0-M14/SEQ ID NO: 135; cadena L, L0/SEQ ID NO: 56) y H0L0-M58 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L0/SEQ ID NO: 56). Se expresó y purificó cada anticuerpo mediante el método descrito en el ejemplo 4.

Se evaluó la heterogeneidad mediante cromatografía de intercambio catiónico. Se evaluaron los anticuerpos preparados para determinar la heterogeneidad usando una columna ProPac WCX-10 (Dionex), acetato de sodio 20 mM (pH 5,0) como fase móvil A, y acetato de sodio 20 mM/NaCl 1 M (pH 5,0) como fase móvil B, con una velocidad de flujo y un gradiente apropiados. El resultado de evaluación mediante cromatografía de intercambio catiónico (IEC) se muestra en la figura 10.

Tal como se muestra en la figura 10, la heterogeneidad aumentó mediante la conversión de la región constante de IgG1 a IgG2 en el anticuerpo anti-receptor de IL-31, y la heterogeneidad puede reducirse mediante la conversión de la región constante a M14 o M58 en cualquier anticuerpo.

[Ejemplo 6] Efecto de mejora de la farmacocinética de la región constante novedosa M58 en anticuerpos anti- receptor de IL-31 Tal como se muestra en el ejemplo de referencia 9, se encontró que la conversión de la región constante de IgG1 a M58 en anticuerpo anti-receptor de IL-6 huPM1 mejoraba su actividad de unión a FcRn humano y la farmacocinética en ratones transgénicos para FcRn humano. Por tanto, también se sometieron a prueba anticuerpos anti-receptor de IL-31 para evaluar si la conversión de la región constante a M58 mejoraba su farmacocinética.

Se evaluaron H0L0-IgG1 (cadena H: H0-IgG1/SEQ ID NO: 133; cadena L: L0/SEQ ID NO: 56) y H0L0-M58 (cadena H: H0-M58/SEQ ID NO: 136; cadena L L0/SEQ ID NO: 56) preparados tal como se describe en los ejemplos 4 y 5 para determinar la actividad de unión a FcRn humano mediante el método descrito en el ejemplo de referencia 9. El resultado se muestra en la tabla 3.

Tabla 3 KD (M) H0L0-IgG1 1,07 H0L0-M58 0,91 Tal como se muestra en la tabla 3, la conversión de la región constante de IgG1 a M58 también mejoró la actividad de unión a FcRn humano del anticuerpo anti-receptor de IL-31 H0L0 como en el anticuerpo anti-receptor de IL-6 hPM1. Esto sugiere que la conversión de la región constante de IgG1 a M58 puede mejorar la farmacocinética del anticuerpo anti-receptor de IL-31 en ser humano.

[Ejemplo 7] Identificación de sitios de mutación que reducen el punto isoeléctrico Producción de mutantes Se produjo cada mutante mediante el método descrito en el ejemplo 4 o mediante PCR de ensamblaje. En el método que usa PCR de ensamblaje, se sintetizaron ADN de oligos basándose en secuencias directas e inversas que incluyen un sitio alterado. Se combinaron ADN de oligo directo que incluye un sitio alterado y ADN de oligo inverso que se une al vector en el que se insertó el gen que iba a alterarse, y se combinaron ADN de oligo inverso que incluye un sitio alterado y ADN de oligo directo que se une al vector en el que se insertó el gen que iba a alterarse. Se llevó a cabo PCR usando PrimeSTAR (Takara) para producir fragmentos de extremo 5’ y extremo 3’ que incluían el sitio alterado. Se ensamblaron los dos fragmentos mediante PCR de ensamblaje para producir cada mutante. Se insertó el mutante producido en un vector de expresión que puede expresar el gen insertado en células animales. Se determinó la secuencia de nucleótidos del vector de expresión resultante mediante un método conocido por los expertos en la técnica. Se produjeron y purificaron anticuerpos mediante el método descrito en el ejemplo 4.

Identificación de sitios de mutación Para mejorar la farmacocinética de H0L0 (cadena H, H0-SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56), se examinaron sitios alterados que pueden reducir el punto isoeléctrico de la región variable. La selección de sitios de mutación en las regiones variables predichos a partir del modelo de estructura tridimensional reveló sitios de mutación que disminuirán el punto isoeléctrico de las regiones variables sin reducir significativamente su unión a NR10. Éstos se resumen en la tabla 4 (Hp5-VH/SEQ ID NO: 137, Hp7-VH/SEQ ID NO: 138, Hp8-VH/SEQ ID NO: 139, Hp6-VH/SEQ ID NO: 140, Hp9-VH/SEQ ID NO: 141, Hp1-VH/SEQ ID NO: 142, Hp13-VH/SEQ ID NO: 143, Lp1- VL/SEQ ID NO: 144, Lp2-VL/SEQ ID NO: 145, Lp3-VL/SEQ ID NO: 146, Lp4-VL/SEQ ID NO: 147, Lp7-VL/SEQ ID NO: 148, Lp5-VL/SEQ ID NO: 149, Lp6-VL/SEQ ID NO: 150). Se produjo y purificó cada variante mediante el método descrito en el ejemplo 4.

Se sometió a prueba cada variante para determinar la actividad de inhibición de la unión de hIL-31/hNR10 usando FMAT. Se llevó a cabo la prueba según el método descrito en el ejemplo 4. Tal como se muestra en la figura 11, la actividad de competencia de cada variante no se redujo mucho en comparación con la de H0L0.

Tabla 4 Nombre Tipo Secuencia de H0 Sitio de Secuencia Aminoácido Secuencia mutación de H0 tras la tras la mutación (n.º de mutación Kabat) Hp5 FR2 WVRQAPGQGLEWMG 38 R Q WVQOSPGQGLEWMG (SEQ ID NO: 97) *A S (SEQ ID NO: 120) Hp7 CDR2 LINPYNGGTSYNQKFKG L E EINPYNGGTSYNQKFKG (SEQ ID NO: 10) (SEQ ID NO: 113) Hp8 CDR2 LINPYNGGTSYNQKFKG 52 N D LIDPYNGGTSYNQKFKG (SEQ ID NO: 10) (SEQ ID NO: 114) Hp6 CDR2 LINPYNGGTSYNQKFKG 61 Q D LINPYNGGTSYNDKFKG (SEQ ID NO: 10) (SEQ ID NO: 115) Hp9 CDR2 LINPYNGGTSYNQKFKG 62 K Q LINPYNGGTSYNQQFKG (SEQ ID NO: 10) (SEQ ID NO: 116) Hp1 CDR2 LINPYNGGTSYNQKFKG 64 K Q LINPYNGGTSYNQKFQG (SEQ ID NO: 10) (SEQ ID NO: 117) Hp13 CDR2 LINPYNGGTSYNQKFKG 64 K Q LINPYNGGTSYNQKFQD (SEQ ID NO: 10) G D (SEQ ID NO: 119) Nombre Secuencia de L0 Sitio de Secuencia Aminoácido Secuencia mutación de L0 tras la tras la mutación (n.º de mutación Kabat) Lp1 CDR1 RTSENIYSFLA 24 R Q QTSENIYSFLA (SEQ ID NO: 13) (SEQ ID NO: 121) Lp2 CDR1 RTSENIYSFLA 28 N D RTSEDIYSFLA (SEQ ID NO: 13) (SEQ ID NO: 122) Lp3 CDR2 NAKTLAK N D DAKTLAK (SEQ ID NO: 14) (SEQ ID NO: 123) Lp4 CDR2 NAKTLAK 52 K Q NAQTLAK (SEQ ID NO: 14) (SEQ ID NO: 124) Lp7 CDR2 NAKTLAK 54 L E NAKTEAK (SEQ ID NO: 14) (SEQ ID NO: 125) Lp5 CDR2 NAKTLAK 56 K Q NAKTLAQ (SEQ ID NO: 14) (SEQ ID NO: 126) Lp6 CDR2 NAKTLAK 56 K D NAKTLAD (SEQ ID NO: 14) (SEQ ID NO: 127) El asterisco (*) en la tabla 4 anterior indica un sitio que no era relevante para el punto isoeléctrico pero que estaba alterado para la conversión en una secuencia humana.

Los ejemplos de los anticuerpos NS22 humanizados cuyo punto isoeléctrico se ha reducido combinando estas alteraciones incluyen Hp3Lp15 (cadena H: Hp3-SKSC/SEQ ID NO: 151; cadena L: Lp15/SEQ ID NO: 152). Se compararon la afinidad por NR10, el punto isoeléctrico y la retención en plasma en ratones entre Hp3Lp15 y H0L0.

Medición de la afinidad Se determinó la afinidad de cada anticuerpo para NR10 mediante el método descrito en el ejemplo de referencia 10.

El resultado de la medición de afinidad se muestra en la tabla 5. Se mostró que la afinidad de Hp3Lp15 era casi igual que la de H0L0.

Tabla 5 ka (1/Ms) Kd (1/s) KD (M) H0L0 3,7E+05 1,2E-03 3,3E-09 Hp3Lp15 4,2E+05 1,6E-03 3,9E-09 Medición del punto isoeléctrico Se analizó cada anticuerpo mediante electroisoenfoque para evaluar cambios en el punto isoeléctrico de todo el anticuerpo debidos a las alteraciones de aminoácidos en su región variable. Se realizó el electroisoenfoque mediante el siguiente método.

Se hinchó gel para IEF seco Phast-Gel (Amersham Biosciences) en el casete de Phastsystem (Amersham Biosciences) durante aproximadamente 30 minutos usando la disolución de hinchamiento mostrada a continuación.

Agua MilliQ 1,5 ml Pharmalyte 5-8 para IEF (Amersham Biosciences) 100 l Se llevó a cabo electroforesis en PhastSystem (Amersham Biosciences) usando el gel hinchado según el programa indicado a continuación. Se cargaron las muestras sobre el gel en la etapa 2. Se usó el kit de calibración para pI (Amersham Biosciences) como marcador de pI.

Etapa 1: 2000 V 2,5 mA 3,5 W 15ºC 75 Vh Etapa 2: 200 V 2,5 mA 3,5 W 15ºC 15 Vh Etapa 3: 2000 V 2,5 mA 3,5 W 15ºC 410 Vh Tras la electroforesis, se fijó el gel con TCA al 20%, y entonces se tiñó con plata usando el kit de tinción con plata para proteínas (Amersham Biosciences), según el protocolo adjunto al kit. Tras la tinción, se calculó el punto isoeléctrico de la muestra (todo el anticuerpo) a partir de los puntos isoeléctricos conocidos de los marcadores de pI.

El resultado de la medición del punto isoeléctrico mediante electroisoenfoque mostró que el punto isoeléctrico de H0L0 era de aproximadamente 7,8, y el punto isoeléctrico de Hp3Lp15 era de aproximadamente 5,5, mostrando que el punto isoeléctrico de Hp3Lp15 disminuía en aproximadamente 2,3 en comparación con H0L0. Cuando se calculó el punto isoeléctrico teórico de la región variable VH/VL mediante GENETYX (GENETYX CORPORATION), los puntos isoeléctricos teoréticos de las regiones variables de H0L0 y Hp3Lp15 fueron de 7,76 y 4,63, respectivamente.

Por tanto, el punto isoeléctrico teórico de Hp3Lp15 disminuyó en 3,13 en comparación con H0L0.

Evaluación de la farmacocinética de anticuerpo con punto isoeléctrico reducido usando ratones Con el fin de evaluar la retención en plasma de Hp3Lp15, un anticuerpo modificado con punto isoeléctrico reducido, se comparó la retención en plasma de H0L0 y Hp3Lp15 en ratones normales. Se administró una única dosis de H0L0 o Hp3Lp15 por vía intravenosa a 1 mg/kg a ratones (C57BL/6J, Charles River Japan, Inc.) para comparar el transcurso temporal de la concentración en plasma. Se determinaron las concentraciones en plasma mediante ELISA. Se dispensaron concentraciones apropiadas de una muestra de calibración y muestras de plasma de prueba en placas Immunoplate (Nunc-Immuno Plate, MaxiSorp (Nalge Nunc International)) recubiertas con anticuerpo anti- IgG humana (específico de Fc) (Sigma). Se permitió que las muestras estuvieran en reposo a temperatura ambiente durante una hora. Tras la reacción con anticuerpo de cabra anti-IgG humana-ALP (Sigma) a temperatura ambiente durante una hora, se llevó a cabo la reacción de desarrollo de color usando el sistema de sustratos de fosfatasa de micropocillos BluePhos (Kirkegaard & Perry Laboratories) como sustrato. Se midió la absorbancia a 650 nm con un lector de microplacas. Se determinaron las concentraciones en plasma basándose en la absorbancia de la curva de calibración usando el software analítico SOFTmax PRO (Molecular Devices).

Se calcularon parámetros farmacocinéticos (AUC y aclaramiento sistémico (CL)) a partir de los datos de transcurso temporal obtenidos de la concentración en plasma usando el software de análisis farmacocinético WinNonlin (Pharsight). Los parámetros se muestran en la tabla 6. AUC y el aclaramiento de Hp3Lp15 tras la administración intravenosa aumentaron en aproximadamente el 14% y se redujeron en aproximadamente el 12%, respectivamente, en comparación con H0L0. Por tanto, se demostró que Hp3Lp15, en el que el punto isoeléctrico de H0L0 se ha reducido, tenía una farmacocinética mejorada.

Tabla 6 AUC (g·d/kg) CL (ml/d/kg) Media D.E.

Media D.E.

H0L0 281,8 13,1 3,6 0,2 Hp3Lp15 312,1 26,1 3,1 0,3 [Ejemplo 8] Efecto de combinaciones de región variable y región constante sobre la actividad biológica Con el fin de evaluar los efectos de diferentes regiones constantes sobre la actividad biológica, se produjeron las siguientes variantes.

Se combinaron SKSC (SEQ ID NO: 62) y M58 (SEQ ID NO: 128), regiones constantes preparadas en los ejemplos de referencia 7 y 9, con Hp3 (Hp3-VH/SEQ ID NO: 167), una región variable preparada en el ejemplo 7, para producir Hp3-M58 (SEQ ID NO: 240) y Hp3-SKSC (SEQ ID NO: 151) como cadenas H. Se combinaron las cadenas H preparadas con Lpl5 (Lp15/SEQ ID NO: 152), una cadena L preparada en el ejemplo 7, para producir Hp3Lp15- SKSC (cadena H, Hp3-SKSC/SEQ ID NO: 151; cadena L, Lp15/SEQ ID NO: 152) y Hp3Lp15-M58 (cadena H, Hp3- M58/SEQ ID NO: 240; cadena L, Lp15/SEQ ID NO: 152). Se expresó y purificó cada anticuerpo mediante el método descrito en el ejemplo 4.

Se evaluaron los anticuerpos producidos tal como se describió anteriormente, H0L0-SKSC (cadena H, H0- SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56) preparado usando la región constante SKSC (SEQ ID NO: 62) descrita en el ejemplo de referencia 7, y H0L0-M58 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L0/SEQ ID NO: 56) y H0L0-IgG2 (cadena H, H0-IgG2/SEQ ID NO: 134; cadena L, L0/SEQ ID NO: 56) preparadas en el ejemplo 5, para determinar la actividad biológica mediante el método descrito en el ejemplo 2 usando BaF/NR10. El resultado se resume en la figura 18.

Tal como se muestra en la figura 18, no se detectó ninguna diferencia significativa en la actividad biológica entre las regiones constantes. Puesto que la actividad biológica no se vio afectada cuando se combinaron las dos regiones variables H0 y Hp3 con cada región constante, la combinación de regiones variables creadas en el fututo con cualquier región constante no dará como resultado una alteración de la actividad biológica.

[Ejemplo 9] Identificación de sitios de mutación que suprimen la degradación mediante estudio de aceleración térmica Los anticuerpos usados para productos farmacéuticas tienen heterogeneidad aunque sean anticuerpos monoclonales obtenidos de clones derivados de células que producen anticuerpos individuales. Se sabe que tal heterogeneidad de anticuerpo resulta de modificación tal como oxidación o desamidación, y que aumenta durante el almacenamiento a largo plazo o tras la exposición a condiciones de estrés, tales como estrés térmico o estrés luminoso (véase “Heterogeneity of Monoclonal Antibodies”, Journal of pharmaceutical sciences, vol. 97, n.º 7, 2426- 2447). Sin embargo, cuando se desarrolla un anticuerpo como producto farmacéutico, las propiedades físicas de la proteína, particularmente homogeneidad y estabilidad, son sumamente importantes. Por tanto, se desea que la heterogeneidad de sustancias deseadas/relacionadas se reduzca y que la sustancia se componga de una única sustancia tanto como sea posible. En este contexto, se llevó a cabo el experimento descrito a continuación para evaluar la heterogeneidad de anticuerpo en condiciones de estrés y para reducir la heterogeneidad.

Para evaluar los productos de degradación, se preparó una muestra acelerada de H0L0 (cadena H, H0-SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56) mediante el método descrito a continuación. Se analizaron la muestra acelerada preparada y la muestra no acelerada (inicial) mediante cromatografía de intercambio catiónico usando el método descrito a continuación.

- Método para preparar muestras aceleradas Tampón: PBS Concentración de anticuerpo: de 0,2 a 1,0 mg/ml Temperatura de aceleración: 60ºC Periodo de aceleración: un día - Método para análisis mediante cromatografía de intercambio catiónico Columna: ProPac WCX-10, 4 x 250 mm (Dionex) Fase móvil: (A) MES 25 mmol/l/NaOH, pH 6,1 (B) MES 25 mmol/l/NaOH, NaCl 250 mmol/l, pH 6,1 Velocidad de flujo: 0,5 ml/min Temperatura de columna: 40ºC Gradiente: % de B de 0 a 0 (0-5 min) → de 0 a 30 (5-80 min) Detección: 280 nm Los cromatogramas resultantes para muestras de H0L0 antes y después de la aceleración se muestran en la figura 19. La muestra de H0L0 tras la aceleración tenía una tendencia a mostrar un pico básico aumentado.

Entonces, se llevó a cabo selección para reducir este pico. Como resultado, se encontraron Ha355, Ha356, Ha360 y Ha362. Se combinaron estas variantes de cadena H con L0 para producir Ha355L0 (cadena H, Ha355-SKSC/SEQ ID NO: 242; cadena L, L0/SEQ ID NO: 56), Ha356L0 (cadena H, Ha356-SKSC/SEQ ID NO: 243; cadena L, L0/SEQ ID NO: 56), Ha360L0 (cadena H, Ha360-SKSC/SEQ ID NO: 244; cadena L, L0/SEQ ID NO: 56) y Ha362L0 (cadena H, Ha362-SKSC/SEQ ID NO: 245; cadena L, L0/SEQ ID NO: 56). La secuencia de cada variante se muestra en la tabla 7.

Tabla 7 Nombre Tipo Secuencia de H0 Sitio de Secuencia Aminoácido Secuencia mutación de H0 tras la tras la mutación (n.º de mutación Kabat) Ha355 CDR3 DGYDDGPYTMDY 100d M L DGYDDGPYTLET (SEQ ID NO: 265) 101 D E (SEQ ID NO: 266) 102 Y T Ha356 CDR3 DGYDDGPYTMDY 101 D E DGYDDGPYTMET (SEQ ID NO: 265) 102 Y T (SEQ ID NO: 267) Ha360 CDR3 DGYDDGPYTMDY 97 Y L DGLDDGPYTMET (SEQ ID NO: 265) 101 D E (SEQ ID NO: 268) 102 Y T Ha362 CDR3 DGYDDGPYTMDY 97 Y L DGLDDGPYTMES (SEQ ID NO: 265) 101 D E (SEQ ID NO: 269) 102 Y S Se expresó y purificó cada uno de los anticuerpos identificados mediante el método descrito en el ejemplo 4. Como con H0L0, se preparó una muestra acelerada de cada anticuerpo preparado, y se analizó mediante cromatografía de intercambio catiónico. El resultado se muestra en la figura 19.

El resultado mostró que se redujo la generación del pico básico aumentado tras la aceleración en el anticuerpo modificado que contenía una sustitución de ácido aspártico por ácido glutámico en la posición 101 en la cadena H, en comparación con H0L0. Se evaluaron los anticuerpos modificados para determinar la actividad biológica mediante el método descrito en el ejemplo 2 usando BaF/NR10. El resultado se muestra en la figura 20. Tal como se muestra en la figura 20, las actividades biológicas de los anticuerpos modificados eran comparables a o más fuertes que la de H0L0. Estos hallazgos demostraron que las modificaciones de Ha355, Ha356, Ha360 y Ha362 suprimieron la generación de productos de degradación mediante aceleración, y por tanto eran eficaces en la mejora de la estabilidad del anticuerpo.

[Ejemplo 10] Identificación de sitios de mutación que aumentan la afinidad Se construyó una biblioteca en la que se introdujeron mutaciones en secuencias de CDR y se examinó para mejorar la afinidad de H0L0 por NR10. Como resultado del examen de la biblioteca en la que se introdujeron mutaciones en las CDR, se encontraron mutaciones que mejoran la afinidad por NR10. Las mutaciones se muestran en la tabla 8. Se combinó cada una de las variantes de cadena H Ha101-SKSC (SEQ ID NO: 246), Ha103-SKSC (SEQ ID NO: 247), Ha111-SKSC (SEQ ID NO: 248), Ha204-SKSC (SEQ ID NO: 249) y Ha219-SKSC (SEQ ID NO: 250) con L0 (L0/SEQ ID NO: 56); y se combinó cada una de las cadenas L modificadas La134 (SEQ ID NO: 251), La130 (SEQ ID NO: 252), La303 (SEQ ID NO: 253) y La328 (SEQ ID NO: 254) con H0 (H0-SKSC/SEQ ID NO: 54), para construir un anticuerpo. Se produjo y purificó cada variante mediante el método descrito en el ejemplo 4.

Se evaluó la afinidad de cada anticuerpo por NR10 usando Biacore. El resultado se muestra en la tabla 9. Se llevó a cabo el ensayo usando el método descrito en el ejemplo de referencia 10. Tal como se muestra en la tabla 9, se encontró que el valor de KD para cada variante mejoraba en comparación con el de H0L0 (cadena H, H0- SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56).

Tabla 8 Nombre Tipo Secuencia de H0 Sitio de Secuencia Aminoácido Secuencia mutación de H0 tras la tras la mutación (n.º de mutación Kabat) Ha101 CDR1 GYIMN 33 I V GYVMN (SEQ ID NO: 270) (SEQ ID NO: 272) Ha103 CDR1 GYIMN 34 M I GYIIN (SEQ ID NO: 270) (SEQ ID NO: 273) Ha111 CDR1 GYIMN 34 M L GYILN (SEQ ID NO: 270) (SEQ ID NO: 274) Ha204 CDR2 LINPYNGGTSYNQKFKG 58 S D LINPYNGGTDYNQKFKG (SEQ ID NO: 271) (SEQ ID NO: 275) Ha219 CDR2 LINPYNGGTSYNQKFKG 61 Q P LINPYNGGTSYNPKFKG (SEQ ID NO: 271) (SEQ ID NO: 276) Nombre Secuencia de L0 Sitio de Secuencia Aminoácido Secuencia mutación de L0 tras la tras la mutación (n.º de mutación Kabat) La134 CDR1 RTSENIYSFLA 31 S R RTSENIYRFLA (SEQ ID NO: 277) (SEQ ID NO: 279) La130 CDR1 RTSENIYSFLA 31 S R RTSENIYRFVA (SEQ ID NO: 277) 33 L V (SEQ ID NO: 280) Ls303 CDR3 QHHYESPLT 93 E D QHHYDSPLT (SEQ ID NO: 278) (SEQ ID NO: 281) La328 CDR3 QHHYESPLT 94 S D QHHYEDPLT (SEQ ID NO: 278) (SEQ ID NO: 282) La326 CDR3 QHHYESPLT 97 T F QHHYESPLF (SEQ ID NO: 278) (SEQ ID NO: 283) Tabla 9 Nombre ka (1/Ms) Kd (1/s) KD (M) H0L0 1,9E+05 6,2E-04 3,2E-09 Ha101L0 2,0E+05 3,1E-04 1,5E-09 Ha103L0 2,2E+05 5,3E-04 2,4E-09 Ha111L0 2,6E+05 5,6E-04 2,1E-09 Ha204L0 3,7E+05 4,9E-04 1,3E-09 Ha2191L0 3,2E+05 9,6E-04 3,0E-09 Nombre ka (1/Ms) Kd (1/s) KD (M) H0L0 1,5E+05 7,4E-04 5,1E-09 H0La134 2,5E+05 4,4E-04 1,8E-09 H0La130 2,6E+05 4,0E-04 1,5E-09 H0La303 2,2E+05 4,6E-04 2,1E-09 H0La328 1,8E+05 5,2E-04 2,9E-09 H0La326 1,4E+05 5,2E-04 3,7E-09 Los ejemplos de combinaciones de estas mutaciones de mejora de la afinidad con las mutaciones de disminución del punto isoeléctrico generadas en el ejemplo 7 incluyen, por ejemplo, Ha401La402 (cadena H, Ha401-SKSC/SEQ ID NO: 255; cadena L, La402/SEQ ID NO: 256) y H17L11 (cadena H, H17-M58/SEQ ID NO: 222; cadena L, L11/SEQ ID NO: 236). Se produjo y purificó cada variante mediante el método descrito en el ejemplo 4.

Se evaluó Ha401La402 (cadena H, Ha401-SKSC/SEQ ID NO: 255; cadena L, La402/SEQ ID NO: 256) para determinar su afinidad por NR10 y su actividad biológica mediante el método descrito en el ejemplo de referencia 10 y el método que usa BaF/NR10 descrito en el ejemplo 2, respectivamente, y se compararon con las de H0L0 (cadena H, H0-SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56). El resultado de la medición de afinidad se muestra en la tabla 10, y la actividad biológica determinada usando BaF/NR10 se muestra en la figura 21. Se encontró que tanto la afinidad como la actividad biológica mejoraban en comparación con las de H0L0 (cadena H, H0-SKSC/SEQ ID NO: 54; cadena L, L0/SEQ ID NO: 56).

Tabla 10 Nombre ka (1/Ms) Kd (1/s) KD (M) H0L0 2,9E+05 9,1E-04 3,2E-09 Ha401La402 5,8E+05 2,9E-04 5,0E-010 Además, se evaluó H17L11 (cadena H, H17-M58/SEQ ID NO: 222; cadena L, L11/SEQ ID NO: 236) para determinar su afinidad por NR10 y su actividad biológica mediante el método descrito en el ejemplo 7 y el método que usa BaF/NR10 descrito en el ejemplo 2, respectivamente, y se compararon con las de H0L0 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L0/SEQ ID NO: 56). El resultado de la medición de afinidad se muestra en la tabla 11, y la actividad biológica determinada usando BaF/NR10 se muestra en la figura 22. Se encontró que tanto la afinidad como la actividad biológica mejoraban en comparación con las de H0L0 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L0/SEQ ID NO: 56).

Tabla 11 Nombre ka (1/Ms) Kd (1/s) KD (M) H0L0 1,4E+05 6,9E-04 4,8E-09 H17L11 4,3E+05 2,6E-04 6,2E-010 [Ejemplo 11] Identificación de sitios de mutación que reducen el riesgo de inmunogenicidad Reducción del riesgo de inmunogenicidad en CDR1 de cadena H Se analizaron epítopos de células T presentes en la secuencia de región variable de H0L0 usando TEPITOPE (Methods, dic. de 2004; 34(4): 468-75). Como resultado, se predijo que CDR1 de la cadena H tenía muchos epítopos de células T que se unen a HLA (es decir, tienen secuencias con un alto riesgo de inmunogenicidad). Entonces, se llevó a cabo un análisis de TEPITOPE para examinar sustituciones que reducirían el riesgo de inmunogenicidad de CDR1 de cadena H. Como resultado, se encontró que el riesgo de inmunogenicidad se reducía enormemente mediante sustitución de isoleucina en la posición 33 en la numeración de kabat por alanina (A) (tabla 12). Entonces, se añadió esta alteración a la H17 generada en el ejemplo 10 para producir H19 (H19-M58/SEQ ID NO: 223). Se combinó la H19 generada con L12 para producir H19L12 (cadena H, H19-M58/SEQ ID NO: 223; cadena L, L12/SEQ ID NO: 237). Se produjo y purificó cada variante mediante el método descrito en el ejemplo 4.

Se evaluó el anticuerpo para determinar la afinidad por NR10 y la actividad biológica mediante el método descrito en el ejemplo de referencia 10 y el método que usa BaF/NR10 tal como se describió en el ejemplo 2, respectivamente, y se compararon con las de H0L0 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L0/SEQ ID NO: 56). El resultado de la medición de afinidad se muestra en la tabla 13, y la actividad biológica determinada usando BaF/NR10 se muestra en la figura 23. Se mostró que tanto la afinidad como la actividad biológica eran casi iguales a las de H0L0.

Tabla 12 Nombre Tipo Secuencia de Sitio de mutación Secuencia Aminoácido Secuencia tras la H0 (n.º de kabat) de H0 tras la mutación mutación H19 CDR1 GYIMN 33 I A GYAMN (SEQ ID NO: (SEQ ID NO: 284) 270) Tabla 13 ka (1/Ms) kd (1/s) KD (M) H0L0 1,8E+05 8,7E-04 4,8E-09 H19L12 2,3E+05 1,2E-03 5,1E-09 Reducción del riesgo de inmunogenicidad en CDR1 de cadena L La treonina (T) presente en la posición de numeración de kabat 25 en CDR1 de la cadena L corresponde a alanina (A) o serina (S) en la secuencia de línea germinal. Por tanto, se predice que el riesgo de inmunogenicidad se reduce mediante sustitución de la treonina (T) en la posición 25 por alanina (A) o serina (S) (tabla 14). Por tanto, se añadió la sustitución anterior a L12 para producir L17 (SEQ ID NO: 238). Se combinó la L17 producida con H0 para producir H0L17 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L17/SEQ ID NO: 238). Se produjo y purificó cada variante mediante el método descrito en el ejemplo 4.

Se evaluó cada variante para determinar la afinidad por NR10 y la actividad biológica mediante el método descrito en el ejemplo de referencia 10 y el método que usa BaF/NR10 tal como se describió en el ejemplo 2, respectivamente, y se compararon con las de H0L0 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L0/SEQ ID NO: 56) y H0L12 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L12/SEQ ID NO: 237). Puesto que L12 contiene una secuencia que mejora la afinidad, presenta una afinidad aproximadamente dos veces superior a la de H0L0. El resultado de la medición de afinidad se muestra en la tabla 15, y la actividad biológica determinada usando BaF/NR10 se muestra en la figura 24. Se mostró que tanto la afinidad como la actividad biológica eran casi iguales a las de H0L12.

Tabla 14 Nombre Tipo Secuencia de L0 Sitio de Secuencia Aminoácido Secuencia tras la mutación (n.º de de L0 tras la mutación kabat) mutación Ld-1 CDR1 RTSENIYSFLA T A RASENIYSFLA (SEQ ID NO: 277) (SEQ ID NO: 285) Ld-2 CDR1 RTSENIYSFLA T S RSSENIYSFLA (SEQ ID NO: 277) (SEQ ID NO: 286) Tabla 15 ka (1/Ms) kd (1/s) KD (M) H0L0 1,6E+05 7,8E-04 4,8E-09 H0L12 3,8E+05 7,4E-04 2,0E-09 H0L17 3,9E+05 8,1E-04 2,1E-09 [Ejemplo 12] Preparación de anticuerpo NS22 completamente humanizado Se prepararon regiones variables de variantes de NS22 combinando las mutaciones múltiples que reducen el pI, aumentan la afinidad, suprimen la degradación de la cadena H y reducen el riesgo de inmunogenicidad, todas las cuales se encontraron en los ejemplos anteriores, en H0 (H0-M58/SEQ ID NO: 136), H1 (H1-M58/SEQ ID NO: 257) o L0 (L0/SEQ ID NO: 56), y se sometieron a diversos procedimientos de examen. Como resultado, se encontraron H28L17 (cadena H, H28-M58/SEQ ID NO: 224; cadena L, L17/SEQ ID NO: 238), H30L17 (cadena H, H30-M58/SEQ ID NO: 225; cadena L, L17/SEQ ID NO: 238), H34L17 (cadena H, H34-M58/SEQ ID NO: 226, cadena L, L17/SEQ ID NO: 238), H42L17 (cadena H, H42-M58/SEQ ID NO: 227; cadena L, L17/SEQ ID NO: 238), H44L17 (cadena H, H44- M58/SEQ ID NO: 228; cadena L, L17/SEQ ID NO: 238), H46L17 (cadena H, H46-M58/SEQ ID NO: 229; cadena L, L17/SEQ ID NO: 238), H57L17 (cadena H, H57-M58/SEQ ID NO: 230; cadena L, L17/SEQ ID NO: 238), H71L17 (cadena H, H71-M58/SEQ ID NO: 231; cadena L, L17/SEQ ID NO: 238), H78L17 (cadena H, H78-M58/SEQ ID NO: 232; cadena L, L17/SEQ ID NO: 238), H92L17 (cadena H, H92-M58/SEQ ID NO: 233; cadena L, L17/SEQ ID NO: 238), H97L50 (cadena H, H97-M58/SEQ ID NO: 234; cadena L, L50/SEQ ID NO: 239) y H98L50 (cadena H, H98- M58/SEQ ID NO: 235; cadena L, L50/SEQ ID NO: 239). Se produjo y purificó cada variante mediante el método descrito en el ejemplo 4.

Se evaluó cada variante para determinar la afinidad por NR10 y la actividad biológica mediante el método descrito en el ejemplo de referencia 10 y el método que usa BaF/NR10 tal como se describió en el ejemplo 2, respectivamente, y se compararon con las de H0L0 (cadena H, H0-M58/SEQ ID NO: 136; cadena L, L0/SEQ ID NO: 56). El resultado de la medición de afinidad se muestra en la tabla 16, y la actividad biológica determinada usando BaF/NR10 se muestra en las figuras 25-1 y 25-2. Se mostró que tanto la afinidad como la actividad biológica de cada anticuerpo eran casi iguales o mayores que las de H0L0.

Tabla 16 Muestra ka (1/Ms) kd (1/s) KD (M) H0L0 2,1E+05 8,8E-04 4,2E-09 H28L17 6,4E+05 3,3E-04 5,2E-10 H30L17 6,8E+05 5,7E-04 8,3E-10 H34L17 3,4E+05 1,2E-03 3,6E-09 H42L17 5,7E+05 3,7E-04 6,5E-10 H44L17 6,1E+05 7,2E-04 1,2E-09 H46L17 2,9E+05 1,3E-03 4,6E-09 H57L17 7,1E+05 5,5E-04 7,7E-10 H71L17 3,7E+05 1,2E-03 3,3E-09 H78L17 6,1E+05 7,0E-04 1,1E-09 H92L17 3,1E+05 1,3E-03 4,1E-09 H97L50 3,6E+05 1,3E-03 3,5E-09 H98L50 2,9E+05 1,3E-03 4,6E-09 [Ejemplo 13] Análisis del dominio de unión de anticuerpo neutralizante anti-NR10 (1) Preparación de antígenos silvestres y quiméricos de ser humano/ratón Se fusionaron los genes que codifican para dominios extracelulares silvestres de ser humano y ratón y dominios extracelulares quiméricos de NR10 (hhh (SEQ ID NO: 258), mmm (SEQ ID NO: 259), hhm (SEQ ID NO: 260), mmh (SEQ ID NO: 261), hmm (SEQ ID NO: 262), mhm (SEQ ID NO: 263) y mhh (SEQ ID NO: 264)), a etiqueta de His y etiqueta de Myc (HHHHHHEQKLISEEDL/ SEQ ID NO: 287) en sus extremos C-terminales, se insertaron en un vector de expresión en animales, y se expresaron de manera transitoria usando el sistema de expresión FreeStyle 293 (Invitrogen™). En la figura 26 se muestran diagramas esquemáticos para los NR10-ECD silvestres y quiméricos de ser humano/ratón.

Se purificaron los antígenos silvestres y quiméricos de ser humano/ratón (hhh, mmm, hhm, mmh, hmm, mhm y mhh) a partir de sobrenadantes de cultivo mediante cromatografía en columna de Ni-NTA Superflow. Específicamente, se cargó 1 ml de Ni-NTA Superflow (QIAGEN) sobre una columna vacía Poly-Prep (BioRad), y se añadieron a la misma 30 ml de cada sobrenadante de cultivo. Tras lavar con D-PBS (solución salina tamponada con fosfato de Dulbecco) que contenía cloruro de sodio 150 mM e imidazol 20 mM, se eluyó la columna con D-PBS que contenía cloruro de sodio 150 mM e imidazol 250 mM. Se sometieron las fracciones eluidas a intercambio de tampón con D-PBS y se concentraron usando Amicon-Ultra (Millipore) con un punto de corte de peso molecular de 10 K.

(2) Detección de antígeno de unión mediante inmunotransferencia de tipo Western Se sometió cada uno de los antígenos silvestres y quiméricos de ser humano/ratón preparados a electroforesis a 0,5 g/carril en tres geles de poliacrilamida al 4-20% (Daiichi Pure Chemicals Co.). Se sometieron las proteínas a electrotransferencia sobre membranas de PVDF (Millipore) en un aparato de transferencia semiseco, y se bloquearon las membranas con TBS que contenía leche desnatada al 5%. Se incubó una membrana con 5 g/ml de H44M58L17 (sistema de detección para anticuerpo humanizado anti-NR10 humana); otra con 5 g/ml de ND41 (sistema de detección para anticuerpo de ratón anti-NR10 humana); y la otra con anticuerpo anti-Myc (SantaCruz, n.º de cat. sc-789) diluido 500 veces con TBS que contenía leche desnatada al 5% (sistema de detección para etiqueta de Myc) a temperatura ambiente durante una hora.

Tras lavar tres veces con TBS que contenía Tween™ 20 al 0,05%, se incubaron los anticuerpos secundarios con las membranas. Se usó anticuerpo de cabra anti-IgG de ser humano marcada con fosfatasa alcalina (BIOSOURCE, n.º de cat. AHI0305) para detectar anticuerpo humanizado anti-NR10 humana; se usó anticuerpo de cabra anti-IgG de ratón marcado con fosfatasa alcalina (SantaCruz, n.º de cat. sc-2008) para detectar anticuerpo de ratón anti-NR10 humana; y se usó anticuerpo de cabra anti-IgG de conejo marcado con fosfatasa alcalina (SantaCruz, n.º de cat. sc- 2057) para detectar etiqueta de Myc. Se llevó a cabo la reacción a temperatura ambiente durante una hora. Tras lavar cuatro veces con TBS que contenía Tween™ 20 al 0,05% durante tres minutos, se llevó a cabo un desarrollo de color usando un sistema de 1 componente de sustrato de fosfatasa BCIP/NBT (KPL). Se preparó TBS (solución salina tamponada con Tris) usada en este caso mediante disolución de un paquete de TBS (solución salina tamponada con Tris) en polvo (TaKaRa) en 1 l de agua destilada. El resultado se muestra en la figura 27.

Cuando se usó el anticuerpo humanizado o anticuerpo de ratón, sólo se detectó la unión para hhh, hhm y hmm, que son dominios extracelulares de NR10.

[Ejemplo de referencia 1] Aislamiento de genes de NR10, OSMR e IL-31 de macaco cangrejero Puesto que se consideró que la reactividad cruzada y actividad de neutralización en macacos cangrejeros era importante para la evaluación de la seguridad en la fase preclínica, se aislaron los genes de NR10 y OSMR de macaco cangrejero. Se diseñaron cebadores basándose en información publicada del genoma del macaco Rhesus y otros, y se amplificaron satisfactoriamente los genes de NR10 y OSMR mediante PCR a partir de ADNc pancreático de macaco cangrejero. Las secuencias de los genes de NR10, OSMR e IL-31 de macaco cangrejero aislados se muestran en SEQ ID NO: 65, 69 y 67, respectivamente, y las secuencias de aminoácidos de NR10, OSMR e IL-31 de macaco cangrejero se muestran en SEQ ID NO: 66, 70 y 68, respectivamente.

[Ejemplo de referencia 2] Establecimiento de líneas celulares Ba/F3 que expresan NR10 y OSMR Se insertó el ADNc de NR10 humana de longitud completa (SEQ ID NO: 75) en el vector de expresión pCOS1 (Biochem. Biophys. Res. Commun. 228, págs. 838-45, 1996), y el vector resultante se denominó pCosNR10.3. Se aisló un ADNc de receptor de oncostatina M (OSMR, n.º de registro de GenBank NM003999) mediante PCR a partir de una biblioteca placentaria humana, y se construyó el vector de expresión pCos1-hOSMR de la misma manera. Se introdujeron simultáneamente 10 g de cada uno de los vectores en la línea celular derivada de células pro-B dependientes de IL-3 de ratón, Ba/F3, mediante electroporación (BioRad Gene Pulser, 960 F, 0,33 kV). Tras la introducción, se añadió IL-31 humana (R&D Systems), y se cultivaron las células para obtener una línea celular (célula hNR10/hOSMR/BaF3) que prolifera de manera dependiente de IL-31. Además, se insertó el gen de IL-31 de macaco cangrejero (SEQ ID NO: 67) en un vector de expresión en células de mamífero y se introdujo en la línea celular CHO, DG44. Se obtuvo el sobrenadante de cultivo resultante como IL-31 de macaco cangrejero. Como con hNR10/hOSMR/BaF3, se insertaron los genes de NR10 y OSMR de macaco cangrejero de longitud completa en el vector de expresión pCOS1 y se expresaron en células Ba/F3, y se estableció una línea celular dependiente de IL-31 de macaco cangrejero (célula cynNR10/cynOSMR/BaF3) usando el sobrenadante de cultivo descrito anteriormente.

[Ejemplo de referencia 3] Establecimiento de líneas celulares CHO que expresan NR10 Se insertaron cada uno de los genes para NR10 humana que carece de dominio citoplasmático (SEQ ID NO: 73) y NR10 de macaco cangrejero que carece de dominio citoplasmático (SEQ ID NO: 71) en un vector de expresión en células de mamífero. Se linealizaron los vectores resultantes con una enzima de restricción, y entonces se introdujeron en la línea celular CHO, DG44, mediante electroporación (BioRad Gene Pulser, 25 F, 1,5 kV). Tras la selección farmacológica, se seleccionaron células que expresaban NR10 y se establecieron mediante análisis con FCM usando anticuerpo anti-NR10 humana. La secuencia de aminoácidos codificada por la secuencia de nucleótidos del gen de NR10 humana que carece de dominio citoplasmático (SEQ ID NO: 73) se muestra en SEQ ID NO: 74, y la secuencia de aminoácidos codificada por la secuencia de nucleótidos del gen de NR10 de macaco cangrejero que carece de dominio citoplasmático (SEQ ID NO: 71) se muestra en SEQ ID NO: 72.

[Ejemplo de referencia 4] Preparación de proteína NR10 (dominio extracelular) Se usó el ADNc de NR10 humana como molde para amplificar únicamente el dominio extracelular mediante PCR. Entonces se fusionó la región amplificada con una secuencia de etiqueta FLAG en el extremo C-terminal y se insertó en un vector de expresión en células de mamífero. Se introdujeron diez g del vector linealizado en la línea celular de ovario de hámster chino, DG44, mediante electroporación (BioRad Gene PulserII, 25 F, 1,5 kV). Se obtuvo una línea celular que mostraba un alto nivel de expresión. Se purificó el sobrenadante de la línea celular cultivada a gran escala usando una columna de anticuerpo anti-FLAG (Sigma) y filtración en gel para obtener NR10 soluble. La secuencia de nucleótidos de NR10 soluble se muestra en SEQ ID NO: 77, y la secuencia de aminoácidos se muestra en SEQ ID NO: 78.

[Ejemplo de referencia 5] Preparación de anticuerpos anti-NR10 humana Se inmunizaron ratones con proteína NR10 humana (dominio extracelular) (descrito en el ejemplo de referencia 4), y se prepararon hibridomas mediante un método convencional. Se evaluaron los sobrenadantes de cultivo de estos hibridomas para determinar la actividad de neutralización usando la línea celular dependiente de IL-31 humana (célula hNR10/hOSMR/BaF3) descrita en el ejemplo de referencia 2, y de ese modo se obtuvo NA633 que tiene una actividad de neutralización de NR10.

Además, se llevó a cabo la inmunización con ADN mediante pistola génica impulsada por gas He usando un vector de expresión en mamíferos que portaba el gen de NR10 humana de longitud completa (SEQ ID NO: 75), y se prepararon hibridomas mediante un método convencional. Se evaluaron los sobrenadantes de cultivo de estos hibridomas para determinar la actividad de neutralización usando la línea celular dependiente de IL-31 humana (célula hNR10/hOSMR/BaF3) descrita en el ejemplo de referencia 2, y de ese modo se obtuvo ND41 que tiene una actividad de neutralización de NR10.

[Ejemplo de referencia 6] Preparación de anticuerpo quimérico humano Las secuencias de aminoácidos de regiones variables de cadena pesada y de cadena ligera de NA633 se muestran en SEQ ID NO: 104 y 108, respectivamente. Las secuencias de aminoácidos de CDR1, CDR2 y CDR3 de la región variable de cadena pesada de NA633 se muestran en SEQ ID NO: 105, 106 y 107, respectivamente, mientras que las de CDR1, CDR2 y CDR3 de la región variable de cadena ligera se muestran en SEQ ID NO: 109, 110 y 111, respectivamente. Además, se produjo un anticuerpo quimérico entre estas regiones variables de ratón y región constante humana (cadena H, 1; cadena L, ) mediante un método convencional.

[Ejemplo de referencia 7] Preparación de huPM1-SKSC en el que se reduce la heterogeneidad de IgG2 silvestre sin pérdida de estabilidad Puesto que el anticuerpo NS22 es un anticuerpo neutralizante de NR10, su unión al receptor de Fc puede ser desfavorable teniendo en cuenta la inmunogenicidad y los efectos adversos. Un posible método para reducir la unión al receptor de Fc es seleccionar IgG2 o IgG4 en lugar de IgG1 como isotipo de la región constante (Ann Hematol. junio de 1998; 76(6): 231-48.). Desde el punto de vista del receptor I de Fc y la retención en plasma, IgG2 se ha considerado más deseable que IgG4 (Nat Biotechnol. dic. de 2007; 25(12): 1369-72). Mientras tanto, cuando se desarrolla un anticuerpo como producto farmacéutico, las propiedades de la proteína, particularmente homogeneidad y estabilidad, son sumamente importantes. Se ha notificado que el isotipo IgG2 tiene una heterogeneidad muy alta resultante de enlaces disulfuro en la región bisagra (J Biol Chem. 6 de jun. de 2008; 283(23): 16206-15.). No es fácil, y sería más costoso, fabricarlo como producto farmacéutico a gran escala al tiempo que se mantiene la diferencia en la heterogeneidad de sustancias deseadas/relacionadas entre productos resultantes del anterior. Por consiguiente, se desea que la sustancia se componga de una única sustancia tanto como sea posible. Por tanto, cuando se desarrollan anticuerpos de isotipo IgG2 como productos farmacéuticos, se prefiere reducir la heterogeneidad resultante de enlaces disulfuro, sin reducir la estabilidad.

Con el fin de reducir la heterogeneidad de la IgG2 silvestre, se sustituyeron las cisteínas en la región bisagra y el dominio CH1 de IgG2. Como resultado del examen de diversas variantes, SKSC (SEQ ID NO: 62), que es una región constante obtenida mediante alteración de la cisteína en la posición 131 y arginina en la posición 133 en la numeración de EU (Sequences of Proteins of immunological interest, NIH Publication n.º 91-3242) dentro del dominio CH1 de cadena H de la secuencia de región constante de IgG2 silvestre por serina y lisina, respectivamente, y alteración de la cisteína en la posición de numeración de EU 219 en la región bisagra superior de la cadena H por serina, podía reducir la heterogeneidad sin disminuir la estabilidad. Mientras tanto, otros posibles métodos para reducir la heterogeneidad son alterar sólo la cisteína en la posición de numeración de EU 219 en la región bisagra superior de la cadena H por serina, y alterar sólo la cisteína en la posición de numeración de EU 220 por serina. Por tanto, se produjeron SC de región constante (SEQ ID NO: 153) en la que la cisteína en la posición de numeración de EU 219 en IgG2 se ha alterado por serina, y CS de región constante (SEQ ID NO: 154) en la que la cisteína en la posición de numeración de EU 220 en IgG2 se ha alterado por serina.

Se usaron como cadena H huPM1-SC (SEQ ID NO: 157), huPM1-CS (SEQ ID NO: 158), huPM1-IgG1 (SEQ ID NO: 159), huPM1-IgG2 (SEQ ID NO: 160) y huPM1-SKSC (SEQ ID NO: 161), que se prepararon combinando las regiones constantes producidas como anteriormente, IgG1 (SEQ ID NO: 60) e IgG2 (SEQ ID NO: 132) con la región variable del anticuerpo anti-receptor de IL-6 humanizado (región variable de cadena H, huPM1-VH/SEQ ID NO: 155; región variable de cadena L huPM1-VL/SEQ ID NO: 156) (Cancer Res. 15 de feb. de 1993; 53(4): 851-6), y se usó como cadena L huPM1-L (SEQ ID NO: 162), para producir cada anticuerpo. Se expresó y purificó cada anticuerpo mediante el método descrito en el ejemplo 4.

Se compararon los anticuerpos entre sí en cuanto a la heterogeneidad. Se evaluó la heterogeneidad de huPM1- IgG1, huPM1-IgG2, huPM1-SC, huPM1-CS y huPM1-SKSC mediante cromatografía de intercambio catiónico. Se llevó a cabo la cromatografía usando una columna ProPac WCX-10 (Dionex), acetato de sodio 20 mM (pH 5,0) como fase móvil A, y acetato de sodio 20 mM/NaCl 1 M (pH 5,0) como fase móvil B, con una velocidad de flujo y un gradiente apropiados. El resultado de la evaluación mediante cromatografía de intercambio catiónico se muestra en la figura 12.

Tal como se muestra en la figura 12, la conversión de la región constante de IgG1 en IgG2 aumentó la heterogeneidad. En cambio, la heterogeneidad se redujo notablemente mediante la conversión de la región constante en SKSC. Mientras que SC de región constante dio como resultado una reducción considerable de la heterogeneidad como en SKSC, CS de región constante no mejoró suficientemente la heterogeneidad.

Cuando se desarrolla un anticuerpo como producto farmacéutico, generalmente se desea que el anticuerpo tenga una alta estabilidad además de baja heterogeneidad para la producción de preparaciones estables. Por tanto, para evaluar la estabilidad, se determinó la temperatura del punto medio de desnaturalización térmica (valor de Tm) mediante calorimetría diferencial de barrido (DSC) (VP-DSC; Microcal). La temperatura del punto medio de desnaturalización térmica (valor de Tm) sirve como indicador de la estabilidad. Con el fin de preparar preparaciones estables como productos farmacéuticos, se prefiere una mayor temperatura del punto medio de desnaturalización térmica (valor de Tm) (J Pharm Sci. abr. de 2008; 97(4): 1414-26.). Por tanto, se dializaron huPM1-IgG1, huPM1- IgG2, huPM1-SC, huPM1-CS y huPM1-SKSC frente a una disolución de acetato de sodio 20 mM/NaCl 150 mM (pH 6,0) (EasySEP; TOMY), y se llevó a cabo la medición de DSC usando aproximadamente 0,1 mg/ml de proteína a una velocidad de calentamiento de 1ºC/min entre 40 y 100ºC. Las curvas de desnaturalización obtenidas mediante DSC se muestran en la figura 13. Los valores de Tm de los dominios de Fab se indican en la tabla 17 a continuación.

Tabla 17 Nombre Tm/ºC huPM1-IgG1 94,8 huPM1-IgG2 93,9 huPM1-SC 86,7 huPM1-CS 86,4 huPM1-SKSC 93,7 Los valores de Tm de huPM1-IgG1 y huPM1-IgG2 eran casi iguales, concretamente, de aproximadamente 94ºC (IgG2 era menor en aproximadamente 1ºC). Mientras tanto, los valores de Tm de huPM1-SC y huPM1-CS eran de aproximadamente 86ºC, lo cual era significativamente menor a los de huPM1-IgG1 y huPM1-IgG2. Por otro lado, el valor de Tm de huPM1-SKSC era de aproximadamente 94ºC, y casi el mismo que huPM1-IgG1 y huPM1-IgG2. Puesto que la estabilidad de huPM1-SC y huPM1-CS era notablemente menor a la de IgG2, huPM1-SKSC en la que la cisteína en el dominio de CH1 también se ha alterado por serina puede preferirse más en el desarrollo de productos farmacéuticos. La disminución significativa del valor de Tm de huPM1-SC y huPM1-CS en comparación con IgG2 puede deberse al patrón de enlaces disulfuro de huPM1-SC y huPM1-CS que es diferente del de IgG2.

Además, la comparación de curvas de desnaturalización de DSC mostró que el pico de desnaturalización para el dominio de Fab era agudo en huPM1-IgG1 y huPM1-SKSC, mientras que era más ancho en huPM1-SC y huPM1- CS que los dos anteriores, y huPM1-IgG2 dio un pico con hombro en el lado de menor temperatura del pico de desnaturalización del dominio de Fab. Generalmente el pico de desnaturalización en DSC se vuelve agudo en el caso de un único componente, pero puede volverse ancho cuando están presentes dos o más componentes con valores de Tm diferentes (concretamente, heterogeneidad). Por tanto, se sugirió que huPM1-IgG2, huPM1-SC y huPM1-CS contenían dos o más componentes, y la heterogeneidad de IgG2 natural no se redujo en huPM1-SC y huPM1-CS. Estos hallazgos sugieren que las cisteínas presentes tanto en la región bisagra como en el dominio de CH1 están implicadas en la heterogeneidad de IgG2 natural, y es necesario alterar no sólo la cisteína en la región bisagra sino también la del dominio de CH1 para disminuir la heterogeneidad en DSC. Además, tal como se describió anteriormente, sólo es posible alcanzar una estabilidad equivalente a la de IgG2 natural mediante alteración no sólo de la cisteína en la región bisagra sino también la del dominio de CH1.

Tal como se describió anteriormente, en cuanto a la regiones constantes en las que se ha reducido la heterogeneidad resultante de la región bisagra de IgG2, se descubrió que SC y CS, que son regiones constantes en las que sólo la cisteína en la región bisagra se ha sustituido por serina, pueden ser insuficientes desde el punto de vista de la heterogeneidad y la estabilidad, y que sólo es posible reducir significativamente la heterogeneidad al tiempo que se mantiene la estabilidad comparable a IgG2 mediante sustitución adicional de la cisteína en la posición de numeración de EU 131 en el dominio de CH1 por serina. Tales regiones constantes incluyen SKSC.

[Ejemplo de referencia 8] Producción y evaluación de región constante optimizada, no de unión al receptor de Fc, M14 En el dominio de unión al receptor de Fc de la región constante de IgG2, los residuos en las posiciones de numeración de EU 233, 234, 235 y 236 son de tipo no de unión, mientras que los residuos en las posiciones de numeración de EU 327, 330 y 331 son diferente de los de IgG4, que son de tipo no de unión. Por tanto, es necesario alterar los aminoácidos en las posiciones de numeración de EU 327, 330 y 331 por la secuencia de IgG4 (G2a en Eur J Immunol. ago. de 1999; 29(8):2613-24). Sin embargo, puesto que el aminoácido en la posición de numeración de EU 339 es alanina en IgG4 mientras que es treonina en IgG2, la simple alteración de los aminoácidos en las posiciones de numeración de EU 327, 330 y 331 por la secuencia de IgG4 generará una nueva secuencia peptídica de 9 aminoácidos que no se produce de manera natural que puede ser un péptido de epítopo de células T, provocando así un riesgo de inmunogenicidad. Por tanto, se encontró que la aparición de la nueva secuencia peptídica podía prevenirse mediante alteración de la treonina en la posición de numeración de EU 339 en IgG2 por alanina, además de las alteraciones descritas anteriormente. Además de las mutaciones descritas anteriormente, se mutó la metionina en la posición de numeración de EU 397 a valina para mejorar la estabilidad de IgG2 en condiciones ácidas. Además, en SKSC (SEQ ID NO: 62) producida en el ejemplo de referencia 7, en la que la heterogeneidad resultante de los enlaces disulfuro en la región bisagra se ha mejorado, la introducción de mutaciones en las posiciones 131 y 133 generará una nueva secuencia peptídica de 9 aminoácidos que no se produce de manera natural que puede ser un péptido de epítopo de células T, provocando así un riesgo de inmunogenicidad. Por tanto, se convirtió la secuencia peptídica alrededor de las posiciones 131 a 139 en la misma que IgG1 mediante mutación del ácido glutámico en la posición de numeración de EU 137 a glicina y mutación de la serina en la posición de numeración de EU 138 a glicina. Se produjo la secuencia de región constante M14 (SEQ ID NO: 129) mediante introducción de todas las mutaciones anteriores.

Se llevó a cabo la expresión y purificación de huPM1-M14, preparado usando huPM1-M14 como cadena H y huPM1-L (SEQ ID NO: 162) como cadena L, mediante el método descrito en el ejemplo de referencia 7. Se evaluaron los huPM1-MI4 (SEQ ID NO: 163), huPM1-IgG1 y huPM1-IgG2 preparados para determinar la heterogeneidad usando cromatografía de intercambio catiónico mediante el método descrito en el ejemplo de referencia 7.

Tal como se muestra en la figura 14, la heterogeneidad también se redujo en huPM1-M14 como en huPM1-SKSC.

[Ejemplo de referencia 9] Preparación de huPM1-M58 con heterogeneidad C-terminal de cadena H reducida y farmacocinética mejorada Preparación de molécula de huPM1-M58 huPM1 es un anticuerpo de IgG1. Para la heterogeneidad en la secuencia C-terminal de la cadena H de anticuerpo de IgG, se ha notificado la deleción del residuo de lisina C-terminal y la amidación del grupo amino C-terminal debido a la deleción de los dos aminoácidos C-terminales, glicina y lisina (Anal Biochem. 1 de ene. de 2007; 360(1): 75-83). También en huPM1, aunque el componente principal es una secuencia en la que la lisina C-terminal codificada por la secuencia de nucleótidos se ha delecionado mediante modificación postraduccional, también hay un componente minoritario en el que sigue estando la lisina y un componente minoritario en el que el grupo amino C-terminal se amida debido a la deleción tanto de glicina como de lisina, lo cual contribuye a la heterogeneidad. Producir un producto farmacéutico a gran escala al tiempo que se mantiene la diferencia en la heterogeneidad de sustancias deseadas/relacionadas entre productos no es fácil sino que más bien da como resultado un aumento del coste, y por tanto se desea que la sustancia se componga de una única sustancia tanto como sea posible. Cuando se desarrolla un anticuerpo como producto farmacéutico, se desea la reducción de la heterogeneidad. Por tanto, se desea que el extremo C-terminal de la cadena H no tenga heterogeneidad cuando se desarrolla como producto farmacéutico. También es deseable prolongar la semivida en plasma del anticuerpo con el fin de reducir la dosis de anticuerpo.

Por tanto, se introdujeron las alteraciones descritas a continuación para preparar una región constante novedosa en la que se ha reducido la heterogeneidad en el extremo C-terminal de la cadena H, también se ha mejorado la farmacocinética en comparación con huPM1-IgG1, y también se ha reducido la heterogeneidad derivada de IgG2 silvestre sin pérdida de estabilidad.

Específicamente, en huPM1-SKSC, que tiene alta estabilidad y en el que se reduce la heterogeneidad anteriormente mencionada relacionada con anticuerpos con regiones constantes de isotipo IgG2, se sustituyó el ácido glutámico en la posición de numeración de EU 137 por glicina; la serina en la posición 138 por glicina; la histidina en la posición 268 por glutamina; la arginina en la posición 355 por glutamina; y la glutamina en la posición 419 por ácido glutámico. Además de las sustituciones anteriores, se delecionaron la glicina y la lisina en las posiciones 446 y 447 para reducir la heterogeneidad del extremo C-terminal de cadena H, obteniendo así huPM1-M58 (SEQ ID NO: 164). Se expresó y se purificó huPM1-M58 preparado usando huPM1-M58 como cadena H y huPM1-L (SEQ ID NO: 162) como cadena L mediante el método descrito en el ejemplo 4.

Se evaluaron huPM1-M58, huPM1-IgG1 y huPM1-IgG2 para determinar la heterogeneidad y estabilidad mediante los métodos descritos en el ejemplo 5 usando cromatografía de intercambio catiónico y DSC, respectivamente.

El resultado de DSC se muestra en la tabla 18. Tal como se muestra en las figuras 13 y 16, se encontró que huPM1- M58 mostraba una heterogeneidad reducida sin pérdida de estabilidad como en huPM1-SKSC.

Tabla 18 Nombre Tm/ºC huPM1-IgG1 94,8 huPM1-IgG2 93,9 huPM1-SKSC 93,7 huMP1-M58 93,7 Evaluación de huPM1-M58 para la retención en plasma La retención prolongada (eliminación lenta) de molécula de IgG en plasma se debe a la función de FcRn, que se sabe que es un receptor salvaje de molécula de IgG (Nat Rev Immunol. sep. de 2007; 7(9): 715-25). Cuando se incorporan en endosomas mediante pinocitosis, las moléculas de IgG se unen a FcRn expresado en endosomas en las condiciones ácidas dentro del endosoma (aproximadamente pH 6,0). Mientras que las moléculas de IgG que no se unen a FcRn se transfieren a, y degradan en, lisosomas, las unidas a FcRn se translocan a la superficie celular y entonces se liberan de FcRn al plasma de nuevo en las condiciones neutras en plasma (aproximadamente pH 7,4).

Se sabe que los anticuerpos de tipo IgG incluyen isotipos IgG1, IgG2, IgG3 e IgG4. Se notifica que las semividas en plasma de estos isotipos en seres humanos son de aproximadamente 36 días para IgG1 e IgG2; de aproximadamente 29 días para IgG3; y de 16 días para IgG4 (Nat. Biotechnol. dic. de 2007; 25(12): 1369-72). Por tanto, se cree que la retención de IgG1 e IgG2 en plasma es la más larga. En general, los isotipos de anticuerpos usados como agentes farmacéuticos son IgG1, IgG2 e IgG4. Los métodos notificados para mejorar adicionalmente la farmacocinética de estos anticuerpos de IgG incluyen métodos para mejorar la actividad de unión a FcRn humano descrita anteriormente mediante alteración de la secuencia de la región constante de IgG (J. Biol. Chem. 19 de ene.

de 2007; 282(3): 1709-17; J. Immunol. 1 de ene. de 2006; 176(1): 346-56).

Hay diferencias de especie entre FcRn de ratón y FcRn humano (Proc. Natl. Acad. Sci. USA. 5 de dic. de 2006; 103(49): 18709-14). Por tanto, para predecir la retención de anticuerpos de IgG que tienen una secuencia de región constante alterada en plasma humano, puede ser deseable evaluar la unión a FcRn humano y la retención en plasma en ratones transgénicos para FcRn humano (Int. Immunol. dic. de 2006; 18(12): 1759-69).

Evaluación de la unión a FcRn humano FcRn es un complejo de FcRn y 2-microglobulina. Se prepararon cebadores de ADN de oligo basándose en la secuencia de gen de FcRn humano publicada (J. Exp. Med. (1994) 180 (6), 2377-2381). Se preparó un fragmento de ADN que codificaba para todo el gen mediante PCR usando ADNc humano (Human Placenta Marathon-Ready cDNA, Clontech) como molde y los cebadores preparados. Usando el fragmento de ADN obtenido como molde, se amplificó un fragmento de ADN que codificaba para el dominio extracelular que contenía la región señal (Met1- Leu290) mediante PCR, y se insertó en un vector de expresión en células animales (la secuencia de aminoácidos de FcRn humano/SEQ ID NO: 165). Asimismo, se prepararon cebadores de ADN de oligo basándose en la secuencia de gen de 2-microglobulina humana publicada (Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)). Se preparó un fragmento de ADN que codificaba para todo el gen mediante PCR usando ADNc humano (Hu-Placenta Marathon-Ready cDNA, CLONTECH) como molde y los cebadores preparados. Usando el fragmento de ADN obtenido como, se amplificó un fragmento de ADN que contenía la 2-microglobulina completa que contenía la región señal (Met1-Met119) mediante PCR y se insertó en un vector de expresión en células animales (la secuencia de aminoácidos de 2-microglobulina humana/SEQ ID NO: 166).

Se expresó FcRn humano soluble mediante el siguiente procedimiento. Se introdujeron los plásmidos preparados para FcRn y 2-microglobulina humanos en la línea celular derivada de cáncer de riñón embrionario humano, HEK293H (Invitrogen) usando suero bovino fetal al 10% (Invitrogen) mediante lipofección. Se recogió el sobrenadante de cultivo resultante y se purificó usando IgG Sepharose 6 Fast Flow (Amersham Biosciences) mediante el método descrito en J. Immunol. 1 de nov. de 2002; 169(9):5171-80. Entonces se llevó a cabo una purificación adicional usando HiTrap Q HP (GE Healthcare).

Se evaluó la unión a FcRn humano usando Biacore 3000. Se unió un anticuerpo a proteína L o anticuerpo de conejo anti-cadena Kappa de IgG humana inmovilizado sobre un chip sensor, se añadió FcRn humano como analito para su interacción con el anticuerpo, y se calculó la afinidad (KD) a partir de la cantidad de FcRn humano unido. Específicamente, se inmovilizó proteína L sobre el chip sensor CM5 (BIACORE) mediante el método de acoplamiento de amina usando tampón fosfato de Na 50 mM (pH 6,0) que contenía NaCl 150 mM como tampón de corrida. Entonces, se diluyó un anticuerpo con el tampón de corrida que contenía Tween20 al 0,02%, y se inyectó y se permitió que se uniera al chip. Entonces se inyectó FcRn humano para evaluar la actividad de unión del anticuerpo al FcRn humano.

Se calculó la afinidad usando el software BIAevaluation. Se usó el sensograma obtenido para calcular la cantidad de hFcRn unido al anticuerpo inmediatamente antes del final de la inyección de FcRn humano. Esto se ajustó mediante el método de afinidad en estado estacionario para calcular la afinidad de FcRn humano por el anticuerpo.

Evaluación predictiva de la retención en plasma de huPM1-IgG1 y huPM1-M58 en ser humano usando FcRn humano Se evaluaron las actividades de unión de huPM1-IgG1 y huPM1-M58 a FcRn humano usando BIAcore. Tal como se muestra en la tabla 19, la actividad de unión de huPM1-M58 fue aproximadamente 1,4 veces mayor que la de huPM1-IgG1.

Tabla 19 KD (M) huPM1-IgG1 1,62 huPM1-M58 1,17 Evaluación de la retención en plasma en ratones transgénicos para FcRn humano Se evaluó la farmacocinética en ratones transgénicos para FcRn humano (ratones B6.mFcRn-/-.hFcRn Tg line 276 +/+; Jackson Laboratories) mediante el siguiente procedimiento. Se administró un anticuerpo por vía intravenosa una vez a una dosis de 1 mg/kg a ratones, y se extrajo sangre en puntos de tiempo apropiados. Se centrifugó inmediatamente la sangre extraída a 15.000 rpm durante 15 minutos a 4ºC para obtener plasma. Se almacenó el plasma separado en un congelador a -20ºC o menos hasta su uso. Se determinó la concentración en plasma mediante ELISA.

Evaluación predictiva de la retención en plasma de huPM1-IgG1 y huPM1-M58 en ser humano usando ratones transgénicos para FcRn humano Se evaluó la retención en plasma de huPM1-IgG1 y huPM1-M58 en ratones transgénicos para FcRn humano. Tal como se muestra en la figura 17, el resultado demuestra que se mejoró la farmacocinética de huPM1-M58 en comparación con huPM1-IgG1. Se sugirió que la actividad de unión a FcRn humano estaba correlacionada con la retención en plasma en ratones transgénicos para FcRn humano.

[Ejemplo de referencia 10] Medición de la afinidad en la reacción antígeno-anticuerpo usando Biacore Se llevó a cabo el análisis cinético de la reacción antígeno-anticuerpo usando Biacore T100 (GE Healthcare Biosciences). Se midió la interacción antígeno-anticuerpo mediante inmovilización de rec-proteína A (a continuación en el presente documento proteína A) (ZYMED) sobre un chip sensor, captura de un anticuerpo sobre la proteína A inmovilizada, y entonces reacción del antígeno como analito. Se usaron diversas concentraciones de rhNR10 como antígeno. Se calcularon los parámetros cinéticos, la constante de velocidad de asociación ka (1/Ms) y la constante de velocidad de disociación kd (1/s), a partir de los sensogramas obtenidos mediante la medición. Entonces, se determinó KD (M) basándose en las constantes de velocidad. Se determinó cada parámetro usando el software de evaluación Biacore T100 versión 1.1 (GE Healthcare Biosciences).

Inmovilización de proteína A sobre chip sensor Se inmovilizó proteína A sobre todas las celdas de flujo del chip sensor CM5 (GE Healthcare Biosciences) mediante el método de acoplamiento de amina. Se llevó a cabo el experimento usando HBS-EP+ (HEPES 10 mM, NaCl 0,15 M, EDTA 3 mM, tensioactivo P20 al 0,05% v/v) como tampón de corrida a una velocidad de flujo de 10 l/min. Se activaron los grupos carboxilo de carboximetildextrano en el chip sensor con 100 l de una mezcla 1:1 de EDC (clorhidrato de N-etil-N’-(3-dimetilaminopropil)carbodiimida) 75 mg/ml y NHS (N-hidroxisuccinimida) 11,5 mg/ml, y se permitió que fluyese la proteína A preparada a 50 g/ml usando tampón acetato 10 mM (pH 4,5) para la reacción.

Entonces, se permitió que fluyesen 100 l de clorhidrato de etanolamina 1 M (pH 8,5) para inactivar los grupos activos sin reaccionar. Por último, se inmovilizaron aproximadamente de 4000 a 5000 UR. Se llevó a cabo el experimento a 25ºC en todo momento.

Medición de la afinidad en la reacción antígeno-anticuerpo entre rhNR10 y anticuerpo capturado sobre proteína A El tampón de corrida usado fue HBS-EP+. Se preparó cada anticuerpo a 0,25 g/ml, o se preparó de modo que se unieran aproximadamente 100 UR a proteína A. Se preparó rhNR10 usada como analito a 0, 38,5, 77,0 y 154 nM, o a 0, 19,25 y 77,01 nM usando HBS-EP+. En la medición, en primer lugar, se capturó la disolución de anticuerpo sobre proteína A, y se hizo reaccionar una disolución de analito a una velocidad de flujo de 20 l/min durante tres minutos. Entonces, se cambió la disolución a HBS-EP+, y se midió la fase de disociación durante cinco minutos. Tras la medición de la fase de disociación, se regeneró el chip sensor mediante lavado con glicina-HCl 10 mM (pH 1,5). Se analizaron cinéticamente los sensogramas obtenidos usando el software de análisis de datos específico de Biacore, software de evaluación Biacore T100 versión 1.1.

Aplicabilidad industrial

Los anticuerpos anti-NR10 obtenidos mediante los presentes inventores presentan una actividad de neutralización eficaz contra R10, y son útiles, por ejemplo, como agentes terapéuticos para enfermedades inflamatorias.

Lista de secuencias

<110> CHUGAI SEIYAKU KABUSHIKI KAISHA <120> Anticuerpos anti-NR10 y su uso <130> C1-A0712Y1PPP <150> Documento PCT/JP2008/072152 <151> 05-12-2008 <150> Documento PCT/JP2009/054941 <151> 13-03-2009 <160> 287 <170> PatentIn versión 3.4 <210> 1 <211> 5 <212> PRT <213> Mus musculus

<400> 1 <210> 2 <211> 17 <212> PRT <213> Mus musculus

<400> 2 <210> 3 <211> 12 <212> PRT <213> Mus musculus

<400> 3 <210> 4 <211> 121 <212> PRT <213> Mus musculus

<400> 4 <210> 5 <211> 11 <212> PRT <213> Mus musculus

<400> 5 <210> 6 <211> 7 <212> PRT <213> Mus musculus

<400> 6 <210> 7 <211> 9 <212> PRT <213> Mus musculus

<400> 7 <210> 8 <211> 107 <212> PRT <213> Mus musculus

<400> 8 <210> 9 <211> 5 <212> PRT <213> Mus musculus

<400> 9 <210> 10 <211> 17 <212> PRT <213> Mus musculus

<400> 10 <210> 11 <211> 12 <212> PRT <213> Mus musculus

<400> 11 <210> 12 <211> 121 <212> PRT <213> Mus musculus

<400> 12 <210> 13 <211> 11 <212> PRT <213> Mus musculus

<400> 13 <210> 14 <211> 7 <212> PRT <213> Mus musculus

<400> 14 <210> 15 <211> 9 <212> PRT <213> Mus musculus

<400> 15 <210> 16 <211> 107 <212> PRT <213> Mus musculus

<400> 16 <210> 17 <211> 5 <212> PRT <213> Mus musculus

<400> 17 <210> 18 <211> 17 <212> PRT <213> Mus musculus

<400> 18 <210> 19 <211> 12 <212> PRT <213> Mus musculus

<400> 19 <210> 20 <211> 121 <212> PRT <213> Mus musculus

<400> 20 <210> 21 <211> 11 <212> PRT <213> Mus musculus

<400> 21 <210> 22 <211> 7 <212> PRT <213> Mus musculus

<400> 22 <210> 23 <211> 9 <212> PRT <213> Mus musculus

<400> 23 <210> 24 <211> 107 <212> PRT <213> Mus musculus

<400> 24 <210> 25 <211> 5 <212> PRT <213> Mus musculus

<400> 25 <210> 26 <211> 17 <212> PRT <213> Mus musculus

<400> 26 <210> 27 <211> 8 <212> PRT <213> Mus musculus

<400> 27 <210> 28 <211> 116 <212> PRT <213> Mus musculus

<400> 28 <210> 29 <211> 12 <212> PRT <213> Mus musculus

<400> 29 <210> 30 <211> 7 <212> PRT <213> Mus musculus

<400> 30 <210> 31 <211> 9 <212> PRT <213> Mus musculus

<400> 31 <210> 32 <211> 108 <212> PRT <213> Mus musculus

<400> 32 <210> 33 <211> 1406 <212> ADN <213> Mus musculus

<400> 33 <210> 34 <211> 445 <212> PRT <213> Mus musculus

<400> 34

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 35 <211> 716 <212> ADN <213> Mus musculus

<400> 35

ES 2 552 690 T3   <210> 36 <211> 214 <212> PRT <213> Mus musculus

<400> 36

ES 2 552 690 T3   <210> 37 <211> 1406 <212> ADN <213> Mus musculus

<400> 37

ES 2 552 690 T3   <210> 38 <211> 445 <212> PRT <213> Mus musculus

<400> 38

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 39 <211> 716 <212> ADN <213> Mus musculus

<400> 39 <210> 40 <211> 214 <212> PRT <213> Mus musculus

<400> 40

ES 2 552 690 T3   <210> 41 <211> 1406 <212> ADN <213> Mus musculus

<400> 41

ES 2 552 690 T3   <210> 42 <211> 445 <212> PRT <213> Mus musculus

<400> 42

ES 2 552 690 T3  

ES 2 552 690 T3   <211> 716 <212> ADN <213> Mus musculus

<400> 43 <210> 44 <211> 214 <212> PRT <213> Mus musculus

<400> 44

ES 2 552 690 T3   <210> 45 <211> 1391 <212> ADN <213> Mus musculus

<400> 45

ES 2 552 690 T3   <210> 46 <211> 440 <212> PRT <213> Mus musculus

<400> 46

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 47 <211> 725 <212> ADN <213> Mus musculus

<400> 47

ES 2 552 690 T3   <210> 48 <211> 215 <212> PRT <213> Mus musculus

<400> 48

ES 2 552 690 T3   <210> 49 <211> 425 <212> ADN <213> Artificial <220> <223> una secuencia sintetizada artificialmente <400> 49

ES 2 552 690 T3   <210> 50 <211> 121 <212> PRT <213> Artificial <220> <223> una secuencia sintetizada artificialmente <400> 50 <211> 398 <212> ADN <213> Artificial <220>

ES 2 552 690 T3   <223> una secuencia sintetizada artificialmente <400> 51 <210> 52 <211> 107 <212> PRT <213> Artificial <220> <223> una secuencia sintetizada artificialmente <400> 52 <210> 53 <211> 1422 <212> ADN <213> Artificial <220> <223> una secuencia sintetizada artificialmente <400> 53

ES 2 552 690 T3   <210> 54 <211> 447 <212> PRT <213> Artificial <220> <223> una secuencia sintetizada artificialmente <400> 54

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 55 <211> 719 <212> ADN <213> Artificial <220> <223> una secuencia sintetizada artificialmente <400> 55 <210> 56 <211> 214 <212> PRT

ES 2 552 690 T3   <213> Artificial <220> <223> una secuencia sintetizada artificialmente <400> 56 <210> 57 <211> 327 <212> ADN <213> Homo sapiens

<400> 57

ES 2 552 690 T3   <210> 58 <211> 107 <212> PRT <213> Homo sapiens

<400> 58 <210> 59 <211> 990 <212> ADN <213> Homo sapiens

<400> 59

ES 2 552 690 T3   <210> 60 <211> 330 <212> PRT <213> Homo sapiens

<400> 60

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 61 <211> 984 <212> ADN <213> Homo sapiens

<400> 61 <210> 62

ES 2 552 690 T3   <211> 326 <212> PRT <213> Homo sapiens

<400> 62

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 63 <211> 995 <212> ADN <213> Homo sapiens

<400> 63 <210> 64 <211> 326 <212> PRT <213> Homo sapiens

<400> 64

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 65 <211> 2208 <212> ADN <213> Macaca fascicularis

ES 2 552 690 T3   <400> 65

ES 2 552 690 T3   <210> 66 <211> 735 <212> PRT <213> Macaca fascicularis

<400> 66

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 67 <211> 495 <212> ADN <213> Macaca fascicularis

<400> 67

ES 2 552 690 T3   <210> 68 <211> 164 <212> PRT <213> Macaca fascicularis

<400> 68 <210> 69 <211> 2934

ES 2 552 690 T3   <212> ADN <213> Macaca fascicularis

<400> 69

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 70 <211> 977 <212> PRT <213> Macaca fascicularis

<400> 70

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 71 <211> 1665 <212> ADN <213> Macaca fascicularis

<400> 71

ES 2 552 690 T3   <210> 72 <211> 553

ES 2 552 690 T3   <212> PRT <213> Macaca fascicularis

<400> 72

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 73 <211> 1665 <212> ADN <213> Homo sapiens

<400> 73

ES 2 552 690 T3   <210> 74 <211> 553

ES 2 552 690 T3   <212> PRT <213> Homo sapiens

<400> 74

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 75 <211> 2199 <212> ADN <213> Homo sapiens

<400> 75

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 76 <211> 732 <212> PRT <213> Homo sapiens

<400> 76

ES 2 552 690 T3  

ES 2 552 690 T3   <400> 77 <210> 78 <211> 514 <212> PRT <213> Homo sapiens

<400> 78

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 79 <211> 662 <212> PRT <213> Homo sapiens

<400> 79

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 80 <211> 732 <212> PRT <213> Homo sapiens

<220> <221> SEÑAL <222> (1)..(20) <220> <221> TRANSMEM

ES 2 552 690 T3   <222> (520) .. (543) <400> 80

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 81 <211> 716 <212> PRT <213> Mus musculus

<400> 81

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 82 <211> 4 <212> PRT <213> Artificial <220> <223> una secuencia peptídica sintetizada artificialmente <400> 82 <210> 83 <211> 4 <212> PRT <213> Artificial <220>

ES 2 552 690 T3   <223> una secuencia peptídica sintetizada artificialmente <400> 83 <210> 84 <211> 5 <212> PRT <213> Artificial <220> <223> una secuencia peptídica sintetizada artificialmente <400> 84 <210> 85 <211> 5 <212> PRT <213> Artificial <220> <223> una secuencia peptídica sintetizada artificialmente <400> 85 <210> 86 <211> 6 <212> PRT <213> Artificial <220> <223> una secuencia peptídica sintetizada artificialmente <400> 86 <210> 87 <211> 6 <212> PRT <213> Artificial <220>

ES 2 552 690 T3   <223> una secuencia peptídica sintetizada artificialmente <400> 87 <210> 88 <211> 7 <212> PRT <213> Artificial <220> <223> una secuencia peptídica sintetizada artificialmente <400> 88 <210> 89 <211> 7 <212> PRT <213> Artificial <220> <223> una secuencia peptídica sintetizada artificialmente <400> 89 <210> 90 <211> 40 <212> ADN <213> Artificial <220> <223> una secuencia de cebador sintetizada artificialmente <400> 90 taatagcggc cgctcattat ttaccaggag agtgggagag <210> 91 <211> 40 <212> ADN <213> Artificial <220> <223> una secuencia de cebador sintetizada artificialmente <400> 91 taatagcggc cgctcattaa cactcattcc tgttgaagct

ES 2 552 690 T3   <210> 92 <211> 33 <212> ADN <213> Artificial <220> <223> una secuencia de cebador sintetizada artificialmente <400> 92 gacgaattcc accatgggat ggagctggat ctt 33 <210> 93 <211> 33 <212> ADN <213> Artificial <220> <223> una secuencia de cebador sintetizada artificialmente <400> 93 gacgaattcc accatgagtg tgcccactca ggt 33 <210> 94 <211> 33 <212> ADN <213> Artificial <220> <223> una secuencia de cebador sintetizada artificialmente <400> 94 gacgaattcc accatggaat gtaactggat act 33 <210> 95 <211> 33 <212> ADN <213> Artificial <220> <223> una secuencia de cebador sintetizada artificialmente <400> 95 gacgaattcc accatggatt ttctggtgca gat 33 <210> 96 <211> 30 <212> PRT <213> Homo sapiens

<400> 96

ES 2 552 690 T3   <210> 97 <211> 14 <212> PRT <213> Homo sapiens

<400> 97 <210> 98 <211> 32 <212> PRT <213> Homo sapiens

<400> 98 <210> 99 <211> 11 <212> PRT <213> Homo sapiens

<400> 99 <210> 100 <211> 23 <212> PRT <213> Homo sapiens

<400> 100 <210> 101 <211> 15 <212> PRT

ES 2 552 690 T3   <213> Homo sapiens

<400> 101 <210> 102 <211> 32 <212> PRT <213> Homo sapiens

<400> 102 <210> 103 <211> 10 <212> PRT <213> Homo sapiens

<400> 103 <210> 104 <211> 119 <212> PRT <213> Mus musculus

<400> 104

ES 2 552 690 T3   <210> 105 <211> 6 <212> PRT <213> Mus musculus

<400> 105 <210> 106 <211> 15 <212> PRT <213> Mus musculus

<400> 106 <210> 107 <211> 10 <212> PRT <213> Mus musculus

<400> 107 <210> 108

ES 2 552 690 T3   <211> 107 <212> PRT <213> Mus musculus

<400> 108 <210> 109 <211> 11 <212> PRT <213> Mus musculus

<400> 109 <210> 110 <211> 7 <212> PRT <213> Mus musculus

<400> 110 <210> 111 <211> 9 <212> PRT <213> Mus musculus

<400> 111

ES 2 552 690 T3   <210> 112 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 112 <210> 113 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 113 <210> 114 <211> 17 <212> PRT

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 114 <210> 115 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 115 <210> 116 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 116 <210> 117 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 117

ES 2 552 690 T3   <210> 118 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 118 <210> 119 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 119 <210> 120 <211> 14 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 120 <210> 121 <211> 11 <212> PRT <213> Artificial <220>

ES 2 552 690 T3   <223> Una secuencia peptídica sintetizada artificialmente <400> 121 <210> 122 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 122 <210> 123 <211> 7 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 123 <210> 124 <211> 7 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 124 <210> 125 <211> 7 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 125

ES 2 552 690 T3   <210> 126 <211> 7 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 126 <210> 127 <211> 7 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 127 <210> 128 <211> 324 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 128

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 129 <211> 326 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 129

ES 2 552 690 T3   <210> 130 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 130

ES 2 552 690 T3  

ES 2 552 690 T3   <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 131 <210> 132 <211> 326 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 132

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 133 <211> 451 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 133

ES 2 552 690 T3  

ES 2 552 690 T3   <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 134

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 135 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 135

ES 2 552 690 T3  

ES 2 552 690 T3   <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 136

ES 2 552 690 T3   <210> 137 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 137

ES 2 552 690 T3   <210> 138 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 138

ES 2 552 690 T3   <210> 139 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 139

ES 2 552 690 T3   <210> 140 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 140 <210> 141 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 141

ES 2 552 690 T3   <210> 142 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 142

ES 2 552 690 T3   <210> 143 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 143 <210> 144 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 144

ES 2 552 690 T3   <210> 145 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 145 <210> 146 <211> 107 <212> PRT <213> Artificial

ES 2 552 690 T3   <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 146 <210> 147 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 147 <210> 148 <211> 107

ES 2 552 690 T3   <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 148 <210> 149 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 149

ES 2 552 690 T3   <210> 150 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 150 <210> 151 <211> 447 <212> PRT <213> Artificial

ES 2 552 690 T3   <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 151

ES 2 552 690 T3   <210> 152 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 152

ES 2 552 690 T3   <210> 153 <211> 326 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 153

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 154 <211> 326 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 154

ES 2 552 690 T3  

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 155 <210> 156 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 156

ES 2 552 690 T3   <210> 157 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 157

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 158 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 158

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 159 <211> 449 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 159

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 160 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 160

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 161 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 161

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 162 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 162

ES 2 552 690 T3   <210> 163 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 163

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 164 <211> 443 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 164

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 165 <211> 267 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 165

ES 2 552 690 T3   <210> 166 <211> 99 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 166 <210> 167 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 167 <210> 168

ES 2 552 690 T3   <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 168 <210> 169 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 169 <210> 170 <211> 7 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 170

ES 2 552 690 T3   <210> 171 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 171 <210> 172 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 172 <210> 173 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 173 <210> 174 <211> 5 <212> PRT <213> Artificial <220>

ES 2 552 690 T3   <223> Una secuencia peptídica sintetizada artificialmente <400> 174 <210> 175 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 175 <210> 176 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 176 <210> 177 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 177 <210> 178 <211> 17 <212> PRT <213> Artificial

ES 2 552 690 T3   <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 178 <210> 179 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 179 <210> 180 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 180 <210> 181 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 181 <210> 182 <211> 12 <212> PRT <213> Artificial

ES 2 552 690 T3   <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 182 <210> 183 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 183 <210> 184 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 184 <210> 185 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 185 <210> 186 <211> 12 <212> PRT <213> Artificial <220>

ES 2 552 690 T3   <223> Una secuencia peptídica sintetizada artificialmente <400> 186 <210> 187 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 187 <210> 188 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 188 <210> 189 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 189 <210> 190 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 190 <210> 191 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 191 <210> 192 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 192 <210> 193 <211> 9 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 193 <210> 194 <211> 9 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 194

ES 2 552 690 T3   <210> 195 <211> 9 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 195 <210> 196 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 196 <210> 197 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 197 <210> 198 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 198

ES 2 552 690 T3   <210> 199 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 199 <210> 200 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 200 <210> 201 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 201 <210> 202 <211> 11 <212> PRT <213> Artificial <220>

ES 2 552 690 T3   <223> Una secuencia peptídica sintetizada artificialmente <400> 202 <210> 203 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 203 <210> 204 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 204

ES 2 552 690 T3   <210> 205 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 205

ES 2 552 690 T3   <210> 206 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 206

ES 2 552 690 T3   <210> 207 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 207

ES 2 552 690 T3   <210> 208 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 208

ES 2 552 690 T3   <210> 209 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 209

ES 2 552 690 T3   <210> 210 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 210

ES 2 552 690 T3   <210> 211 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 211

ES 2 552 690 T3   <210> 212 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 212

ES 2 552 690 T3   <210> 213 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 213

ES 2 552 690 T3   <210> 214 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 214

ES 2 552 690 T3   <210> 215 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 215 <210> 216

ES 2 552 690 T3   <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 216 <210> 217 <211> 121 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 217

ES 2 552 690 T3   <210> 218 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 218

ES 2 552 690 T3   <210> 219 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 219

ES 2 552 690 T3   <210> 220 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 220

ES 2 552 690 T3   <210> 221 <211> 107 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 221 <210> 222 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 222

ES 2 552 690 T3   <210> 223 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 223

ES 2 552 690 T3   <210> 224 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 224

ES 2 552 690 T3   <210> 225 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 225

ES 2 552 690 T3   <210> 226 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 226

ES 2 552 690 T3   <210> 227 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 227

ES 2 552 690 T3   <210> 228 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 228

ES 2 552 690 T3   <210> 229 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 229

ES 2 552 690 T3   <210> 230 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 230

ES 2 552 690 T3   <210> 231 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 231

ES 2 552 690 T3   <210> 232 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 232

ES 2 552 690 T3   <210> 233 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 233

ES 2 552 690 T3   <210> 234 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 234

ES 2 552 690 T3   <210> 235 <211> 445 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 235

ES 2 552 690 T3   <210> 236 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 236 <210> 237 <211> 214

ES 2 552 690 T3   <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 237

ES 2 552 690 T3   <210> 238 <211> 214 <212> PRT

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 238

ES 2 552 690 T3   <210> 239 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 239

ES 2 552 690 T3   <210> 240 <211> 445 <212> PRT

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 240

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 241 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 241

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 242 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 242

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 243 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 243

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 244 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 244

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 245 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 245

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 246 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 246

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 247 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 247

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 248 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 248

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 249 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 249

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 250 <211> 447 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 250

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 251 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 251

ES 2 552 690 T3   <210> 252 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 252

ES 2 552 690 T3   <210> 253 <211> 214 <212> PRT

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 253

ES 2 552 690 T3   <210> 254 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 254

ES 2 552 690 T3   <210> 255 <211> 447 <212> PRT

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 255

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 256 <211> 214 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 256

ES 2 552 690 T3   <210> 257 <211> 445

ES 2 552 690 T3   <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 257

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 258 <211> 530 <212> PRT <213> Homo sapiens

<400> 258

ES 2 552 690 T3  

ES 2 552 690 T3   <400> 259

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 260 <211> 531 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 260

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 261 <211> 516 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 261

ES 2 552 690 T3  

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 262

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 263 <211> 524 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 263

ES 2 552 690 T3  

ES 2 552 690 T3   <210> 264 <211> 523 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 264

ES 2 552 690 T3  

ES 2 552 690 T3   <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 265 <210> 266 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 266 <210> 267 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 267 <210> 268 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 268 <210> 269 <211> 12 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 269 <210> 270 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 270 <210> 271 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 271 <210> 272 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 272 <210> 273 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente

ES 2 552 690 T3   <400> 273 <210> 274 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 274 <210> 275 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 275 <210> 276 <211> 17 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 276 <210> 277

ES 2 552 690 T3   <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 277 <210> 278 <211> 9 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 278 <210> 279 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 279 <210> 280 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 280 <210> 281 <211> 9 <212> PRT

ES 2 552 690 T3   <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 281 <210> 282 <211> 9 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 282 <210> 283 <211> 9 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 283 <210> 284 <211> 5 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 284 <210> 285 <211> 11 <212> PRT <213> Artificial

ES 2 552 690 T3   <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 285 <210> 286 <211> 11 <212> PRT <213> Artificial <220> <223> Una secuencia peptídica sintetizada artificialmente <400> 286 <210> 287 <211> 16 <212> PRT <213> Artificial <220> <223> Una secuencia sintetizada artificialmente <400> 287

ES 2 552 690 T3  

REIVINDICACIONES

1.

Anticuerpo anti-NR10 que es uno cualquiera de: (1) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H30, H44) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); (2) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 196, CDR2 de SEQ ID NO: 197 y CDR3 de SEQ ID NO: 184 (H28, H42) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); (3) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 197, CDR3 de SEQ ID NO: 184 (H34, H46) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); (4) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H57, H78) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); (5) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 176, CDR2 de SEQ ID NO: 198 y CDR3 de SEQ ID NO: 184 (H71, H92) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 202, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L17); y (6) un anticuerpo que comprende una región variable de cadena pesada que comprende CDR1 de SEQ ID NO: 9, CDR2 de SEQ ID NO: 199 y CDR3 de SEQ ID NO: 184 (H97, H98) y una región variable de cadena ligera que comprende CDR1 de SEQ ID NO: 203, CDR2 de SEQ ID NO: 170 y CDR3 de SEQ ID NO: 193 (L50).

2.

Anticuerpo anti-NR10 según la reivindicación 1, que es uno cualquiera de: (1) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 210 (H44) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H44L17); (2) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 207 (H30) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H30L17); (3) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 209 (H42) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H42L17); (4) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 206 (H28) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H28L17); (5) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 211 (H46) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H46L17); (6) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 208 (H34) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H34L17); (7) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 214 (H78) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H78L17); (8) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 212 (H57) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H57L17); (9) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de

ES 2 552 690 T3   aminoácidos de SEQ ID NO: 215 (H92) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H92L17); (10) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 213 (H71) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 220 (L17) (H71L17); (11) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 217 (H98) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 221 (L50) (H98L50); y (12) un anticuerpo que comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 216 (H97) y una región variable de cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 221 (L50) (H97L50).

3.

Anticuerpo anti-NR10 según la reivindicación 1 ó 2, que es un anticuerpo humanizado.

4.

Anticuerpo anti-NR10 según la reivindicación 2, que es uno cualquiera de: (1) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 228 (H44) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H44L17); (2) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 225 (H30) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H30L17); (3) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 227 (H42) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H42L17); (4) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 224 (H28) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H28L17); (5) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 229 (H46) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H46L17); (6) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 226 (H34) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H34L17); (7) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 232 (H78) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H78L17); (8) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 230 (H57) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H57L17); (9) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 233 (H92) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H92L17); (10) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 231 (H71) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 238 (L17) (H71L17); (11) un anticuerpo que comprende una cadena pesada la secuencia de aminoácidos de SEQ ID NO: 235 (H98) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 239 (L50) (H98L50); y (12) un anticuerpo que comprende una cadena pesada que comprende la secuencia de aminoácidos de SEQ ID NO: 234 (H97) y una cadena ligera que comprende la secuencia de aminoácidos de SEQ ID NO: 239 (L50) (H97L50).

5.

Composición farmacéutica que comprende el anticuerpo anti-NR10 según una cualquiera de las reivindicaciones 1 a 4.

ES 2 552 690 T3   6.

Anticuerpo anti-NR10 según una cualquiera de las reivindicaciones 1 a 4, para su uso en el tratamiento de una enfermedad inflamatoria.

7.

Uso del anticuerpo anti-NR10 según una cualquiera de las reivindicaciones 1 a 4, en la fabricación de un medicamento para el tratamiento de una enfermedad inflamatoria.

ES 2 552 690 T3  

ES 2 552 690 T3